Details for Arabidopsis Locus AT1G76020

Position : Chr1 ( 5`- 28532097 .. 28533567 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76020

Protein [Map View]
MIRAVLLFLVFVVETRVQAQLVPPVRQDGFVYPPGHRFDPDTILIEAYFDPVCPDSRDSWPPLKQALHHYGSRVALLLHL
LPLPYHDNAYVTSRALHIVNTVHANATFSLLEGFFKHQSLFYNAQTQLLSRPAVVEKIVELGTVSLGNSYQSVLKSGFSD
KKSDRATRVSFKYSASRGVYGTPTFYVNGFVLSDAASPSNFGGWKKIIDPLVQAHEMEDNFIPFL*

DNA
ATGATTCGAGCGGTTCTCCTGTTCCTTGTCTTCGTCGTTGAGACGAGAGTACAAGCGCAGCTAGTGCCGCCGGTGAGGCA
AGATGGTTTCGTTTACCCACCGGGTCATCGTTTCGACCCGGATACTATACTAATTGAGGCGTATTTTGACCCGGTTTGCC
CGGACAGTAGAGACTCTTGGCCGCCACTGAAGCAAGCTCTTCATCACTATGGATCTCGCGTTGCCCTTCTCCTCCATCTC
CTTCCTTTACCCTACCATGACAATGCCTATGTAACATCACGGGCCTTACACATTGTGAATACCGTACACGCCAATGCTAC
CTTCAGTTTGCTGGAAGGGTTCTTCAAGCATCAGTCATTGTTTTACAACGCGCAAACACAACTCCTTTCAAGACCTGCAG
TTGTGGAGAAAATAGTCGAACTTGGAACAGTCTCGTTGGGGAACTCATATCAATCGGTTCTTAAATCCGGCTTCAGCGAC
AAAAAATCGGATCGTGCAACCAGAGTTTCCTTCAAGTATAGCGCTTCAAGAGGGGTTTATGGTACACCAACCTTCTACGT
TAACGGGTTTGTATTGTCTGATGCTGCTTCCCCTTCAAATTTTGGAGGATGGAAGAAAATCATTGATCCTCTGGTTCAAG
CACATGAGATGGAAGATAACTTCATTCCCTTCCTTTGA