Details for Arabidopsis Locus AT1G75990

Position : Chr1 ( 5`- 28524493 .. 28526776 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75990

Protein [Map View]
MTQDVEMKDNQTPTQSVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRRKLTGSVISSFLDFALVPGSEA
HTRLSSFVPKSDEHDMEVDTASSNSQAPPKHLPAELEIYCYFIVLLFLIDQKKYNEAKVCSTASIARLKSVNRRTVDVIA
SKLYFYYSLSYELTNDLAEIRSTLLALHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCR
YLFYLGKIRTIQLEYTDAKESLLQAARKAPVASLGFRIQCNKWAIIVRLLLGEIPERSIFTQKGMEKTLRPYFELTNAVR
IGDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLNSANPVADAESIVAKAIRDG
AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMA
EEDDDDF*

DNA
ATGACTCAGGACGTAGAGATGAAAGATAACCAAACCCCAACGCAATCCGTCGTCTCTGCTCCTACCTCCACGCTACAGAA
TTTGAAGGAGATTGCAGCTCTGATTGATACTGGATCTTATACAAAGGAAGTCCGTCGTATTGCTCGTGCTGTGCGTCTCA
CCGTTGGACTACGAAGGAAGCTCACGGGTTCCGTGATCTCTTCTTTCCTTGATTTCGCTTTGGTTCCTGGATCTGAAGCT
CACACTCGTCTCTCTTCTTTTGTGCCGAAGAGTGATGAACATGACATGGAAGTTGATACAGCATCATCGAATTCCCAAGC
TCCTCCTAAGCATCTACCTGCAGAGCTCGAGATTTACTGCTACTTCATTGTTCTTCTTTTTCTCATTGATCAGAAAAAGT
ACAACGAGGCCAAAGTTTGTTCTACCGCTAGCATTGCTCGCCTCAAAAGCGTAAACAGGAGAACCGTTGATGTCATTGCT
TCCAAATTGTATTTTTACTACTCCTTAAGTTACGAGCTAACTAATGATCTTGCAGAGATACGTAGTACTCTTCTTGCTCT
TCACCATTCGGCCACACTGCGCCACGACGAATTGGGCCAGGAAACACTTTTGAATCTGTTGCTTCGCAATTATCTACACT
ACAACCTGTACGACCAAGCAGAGAAGTTGAGATCAAAAGCGCCTCGATTTGAGGCACACTCTAACCAACAGTTTTGTAGG
TACTTGTTTTACCTTGGCAAGATCAGGACGATTCAACTTGAGTACACCGATGCAAAAGAGAGTCTCCTCCAAGCTGCTAG
GAAAGCACCTGTTGCATCTCTGGGATTCAGAATCCAGTGCAACAAGTGGGCTATCATAGTTCGGCTGTTGTTGGGTGAAA
TACCTGAACGATCTATCTTCACTCAGAAAGGAATGGAGAAGACTCTTAGGCCATATTTTGAGCTGACCAACGCTGTGAGA
ATTGGTGACTTGGAGCTGTTCGGGAAAATCCAAGAGAAGTTTGCCAAAACATTTGCGGAAGACAGGACTCACAACCTCAT
AGTCAGACTCCGACACAACGTGATCAGAACAGGACTGCGCAACATCAGCATTTCCTACTCCAGAATCTCTCTACAGGATG
TTGCTCAAAAGCTGAGACTGAACTCAGCGAACCCAGTGGCTGATGCAGAAAGCATCGTCGCTAAAGCCATTAGAGATGGA
GCAATCGACGCAACCATCGACCACAAGAACGGTTGTATGGTCTCCAAGGAAACAGGAGACATCTACTCCACTAATGAACC
ACAGACTGCGTTTAACTCGAGGATTGCCTTCTGTTTGAATATGCACAATGAAGCGGTTAGAGCACTGAGGTTCCCGCCAA
ACACGCACAGGGAGAAAGAGAGCGAGGAGAAAAGAAGGGAGATGAAACAGCAAGAAGAGGAGCTCGCTAAATACATGGCT
GAGGAAGACGATGATGATTTCTAG