Details for Arabidopsis Locus AT1G75860

Position : Chr1 ( 5`- 28484163 .. 28485951 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75860

Protein [Map View]
MSRVLTCPPLVFARNHVGVQNLVESTKLKRITLDSKKAHRIEKKEKKEKRKEKKETKREKSHKHSIKATDNHHKLIFLPS
KKVSDESDSLEKSGLTDELEEPQKHLGYLSDGSQNSKKRIRDDSPPAVESLIKAAPVAGKPLRIRMVFKKPKEEVPTLPR
EAVVCSTTVAKSLSHQDVITSSISSSKTSELEKNLPSTSIAAIDETKKRKKHRSSKEDQYNALFDGWTPPSMCIADASSN
DNGDYWLFGNKTQEVLKPKAAVKVDDDTMMRPGDSSWPRAQFLSEVGIYSLPYTVPF*

DNA
ATGTCGCGCGTTCTCACTTGCCCACCGCTTGTGTTTGCAAGAAACCACGTTGGCGTTCAAAACTTGGTCGAATCGACTAA
GCTTAAAAGAATCACACTTGATTCAAAAAAGGCGCACCGGATAGAGAAGAAGGAAAAGAAGGAGAAGAGAAAAGAAAAGA
AAGAAACTAAGCGTGAGAAATCGCATAAACATTCGATTAAAGCAACTGATAATCATCACAAGCTAATATTTCTTCCTTCC
AAGAAAGTGTCAGATGAGTCTGACTCACTAGAGAAGAGTGGTTTGACAGATGAGCTTGAGGAACCTCAAAAACACCTTGG
ATATTTGTCTGATGGAAGTCAGAATAGTAAGAAGAGGATTAGAGATGATTCTCCTCCGGCTGTTGAAAGTCTCATCAAAG
CTGCACCTGTAGCAGGTAAACCTCTACGGATTAGAATGGTCTTCAAAAAACCAAAGGAGGAAGTTCCTACTCTGCCTAGA
GAGGCTGTTGTTTGCTCCACTACAGTTGCAAAGTCGCTCAGTCACCAAGATGTCATAACAAGTTCTATCTCAAGTTCAAA
AACATCCGAGCTTGAAAAGAATCTGCCGTCAACATCAATAGCGGCAATAGATGAAACAAAGAAGAGAAAGAAACACAGAT
CTAGCAAAGAAGATCAATACAATGCATTGTTTGATGGTTGGACTCCTCCTTCCATGTGTATTGCTGATGCATCTTCAAAT
GACAATGGTGATTATTGGCTATTTGGGAACAAGACGCAAGAGGTGCTTAAGCCCAAAGCAGCAGTCAAGGTTGATGATGA
CACGATGATGAGACCGGGAGATTCATCTTGGCCTAGAGCTCAATTTTTGTCTGAAGTTGGGATTTATTCTTTACCTTATA
CTGTCCCGTTCTAA