Details for Arabidopsis Locus AT1G75850

Position : Chr1 ( 5`- 28477768 .. 28483928 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75850

Protein [Map View]
MRTLAGVEDEDKWLAEGIAGIQHNAFFMHRALDANNLREVLKYSALMLSELRTSKLSPQKYYDLYMRAFDQLRQLEIFFK
DESRHGLPVVDLYELVQHAGNILPRMYLLCTVGSVYIKSKQAPSKDVLKDLVEMCRGVQHPIRGLFLRSYLAQVSRDKLP
EIGSDYEGDANTVMDAVEFVLQNFTEMNKLWVRIQHQGPGTVREKQEKERNELRDLVGKNLHVLGQIEGVDLEMYKETVL
PRVLEQVVNCKDKLAQYYLMECIIQVFPDEYHLQTLETLLAACTQLMPTVDTKIVLTQLMDRLSNYAASSPDVLHEFLQV
EAFAKLSNAIGKVIDTQLEMPIVGAMTLFVSLLTFTLRVHPDRLDYVDQVLGACVVKLSSVPKLEDARAMKQVVALLSAP
LEKYSDIVTALTLSNYPRVMDHLDDGTNKVMAMLIIQSIMKTDSCISTADKVEVLFELIKGLIKDLDETNAEELDEEDFQ
EEQNSVARLIHMLDNEEPEEMLKIICVVRRHLMTGGPRRLPFTVPPLVFSAVRLVRQLESQGGDIAGEDSATPRKIFQIL
NQTIEVLTSVPCPELALRLYLQCAEAASDCDLEPVAYEFFTQAFMLYEEEIADSKAQVTAIHLIVGTLQRINVFGVENRD
TLTHKATGYSARLLKKPDQCRAVYACSHLFWVDDPDGIKDGERVLLCLRRALRIANAAQQMASATRGSSGPVTLFVEILN
KYIYFFEKGNPHITPSDIQSLIELINNEMQSDNGNTTIHSDPFFTSTLRYIKFIKQKGGLMGEKYDPIKL*

DNA
ATGAGAACGCTCGCCGGAGTAGAAGACGAGGATAAGTGGCTGGCGGAAGGAATCGCCGGAATCCAGCACAACGCTTTCTT
CATGCATCGCGCTTTGGACGCGAATAATCTCAGAGAAGTTCTCAAGTACTCTGCTCTGATGTTATCGGAGCTTCGAACCT
CCAAGCTCTCTCCTCAGAAATATTACGATCTCTATATGAGAGCTTTCGATCAATTGAGGCAGCTGGAGATTTTCTTTAAG
GATGAGAGTAGGCATGGATTACCTGTTGTTGATTTGTATGAACTTGTTCAACATGCCGGCAACATATTGCCCAGAATGTA
TCTGCTATGTACGGTCGGGTCTGTTTATATCAAAAGTAAGCAGGCTCCTTCGAAGGATGTACTTAAGGATCTTGTGGAAA
TGTGTCGAGGTGTTCAACATCCTATTCGTGGCCTCTTTTTGAGGAGTTATCTCGCTCAAGTGAGCAGGGATAAGTTACCT
GAGATTGGCTCAGACTACGAAGGAGATGCAAATACTGTGATGGATGCTGTGGAGTTTGTGCTACAAAATTTCACAGAGAT
GAATAAGCTTTGGGTTCGAATACAGCATCAGGGACCAGGAACAGTTCGAGAAAAGCAGGAGAAAGAGAGGAACGAACTTC
GTGATCTTGTTGGAAAAAATCTGCATGTTCTAGGACAGATAGAAGGTGTTGACCTTGAGATGTACAAAGAGACTGTTCTT
CCTAGGGTCTTAGAGCAGGTCGTCAACTGTAAAGATAAGTTGGCTCAGTATTATCTGATGGAGTGCATAATTCAAGTCTT
TCCTGATGAGTACCATTTGCAGACTCTTGAGACCTTATTGGCTGCTTGTACCCAACTGATGCCAACTGTTGACACGAAGA
TAGTGTTAACCCAACTAATGGACCGGTTATCAAACTATGCTGCCTCAAGTCCAGATGTGTTACACGAATTTTTGCAAGTG
GAAGCTTTTGCTAAATTGAGCAATGCAATTGGAAAGGTGATAGATACACAGCTTGAGATGCCTATTGTCGGAGCTATGAC
TCTGTTTGTCTCTCTTTTGACTTTTACTCTCCGAGTTCATCCTGATCGGCTTGACTATGTGGATCAAGTATTGGGTGCAT
GTGTAGTTAAGCTTTCCAGTGTGCCCAAGCTGGAGGACGCCCGTGCAATGAAACAAGTAGTGGCACTTTTGAGTGCTCCT
TTAGAAAAGTACAGTGACATAGTTACAGCTCTTACATTGTCAAATTATCCGCGTGTCATGGATCATCTTGATGATGGAAC
GAACAAAGTAATGGCTATGCTAATTATTCAAAGTATAATGAAAACTGATTCGTGTATATCAACTGCTGATAAGGTTGAGG
TGCTGTTTGAATTGATAAAAGGACTTATTAAAGATTTGGATGAAACCAACGCGGAGGAGCTTGACGAGGAGGATTTCCAG
GAGGAACAAAATTCAGTAGCCCGTCTCATACATATGCTTGATAATGAAGAACCAGAGGAGATGCTTAAGATTATATGTGT
TGTGAGACGACATCTTATGACAGGAGGACCTCGACGCTTGCCTTTTACTGTTCCCCCACTTGTTTTTTCTGCAGTTAGGT
TGGTGAGGCAGCTAGAATCCCAGGGTGGAGATATAGCAGGAGAAGATTCAGCAACCCCGAGAAAGATTTTTCAGATTCTC
AACCAGACAATCGAGGTTCTTACCTCAGTTCCATGTCCTGAACTGGCTCTAAGGCTCTACCTTCAGTGCGCAGAGGCCGC
AAGTGACTGTGATCTTGAGCCTGTTGCTTATGAATTTTTTACCCAAGCATTTATGTTATACGAGGAAGAAATTGCGGACT
CGAAGGCACAGGTAACTGCGATTCATCTGATCGTTGGAACCTTGCAAAGGATCAATGTCTTTGGTGTTGAAAATAGGGAC
ACCTTGACACATAAGGCAACCGGGTACTCAGCAAGGCTTCTTAAGAAGCCTGACCAATGCCGAGCGGTTTACGCATGCTC
TCACCTCTTTTGGGTCGATGATCCAGATGGTATTAAAGATGGAGAAAGAGTTCTTCTCTGTTTAAGACGTGCACTGAGGA
TAGCGAACGCAGCTCAACAAATGGCTAGTGCAACCAGAGGTAGCAGCGGACCAGTCACGCTGTTTGTTGAAATCTTGAAC
AAGTACATTTACTTCTTTGAGAAAGGGAATCCACATATCACTCCATCTGATATACAGAGCCTCATAGAATTGATCAACAA
TGAGATGCAAAGCGACAACGGTAACACGACAATCCACTCAGATCCCTTCTTTACAAGTACATTGCGTTACATTAAGTTCA
TAAAACAGAAAGGTGGTTTGATGGGTGAGAAATATGACCCTATCAAGCTGTGA