Details for Arabidopsis Locus AT1G75830

Position : Chr1 ( 5`- 28472357 .. 28472891 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75830

Protein [Map View]
MAKSATIVTLFFAALVFFAALEAPMVVEAQKLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
*

DNA
ATGGCTAAGTCTGCTACCATCGTTACTCTTTTCTTCGCTGCTCTTGTTTTCTTTGCTGCTCTTGAAGCACCGATGGTGGT
GGAAGCACAGAAGTTGTGCGAGAGGCCAAGTGGGACATGGTCCGGAGTTTGCGGAAACAGTAACGCGTGCAAGAATCAGT
GCATTAACCTTGAGAAAGCACGACATGGATCTTGCAACTATGTCTTCCCAGCTCACAAATGTATCTGCTACTTCCCATGT
TAA