Details for Arabidopsis Locus AT1G75750

Position : Chr1 ( 5`- 28441526 .. 28442429 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75750

Protein [Map View]
MAISKALIASLLISLLVLQLVQADVENSQKKNGYAKKIDCGSACVARCRLSRRPRLCHRACGTCCYRCNCVPPGTYGNYD
KCQCYASLTTHGGRRKCP*

DNA
ATGGCTATTTCAAAAGCTCTTATCGCTTCTCTTCTCATATCTCTTCTTGTTCTCCAACTCGTCCAGGCTGATGTCGAAAA
CTCACAGAAGAAAAATGGTTACGCAAAGAAGATCGATTGTGGGAGTGCGTGTGTAGCACGGTGCAGGCTTTCGAGGAGGC
CGAGGCTGTGTCACAGAGCGTGCGGGACTTGCTGCTACAGGTGCAACTGTGTGCCTCCGGGTACGTACGGAAACTACGAC
AAGTGCCAGTGCTACGCTAGCCTCACCACCCACGGTGGACGCCGCAAGTGCCCATAA