Details for Arabidopsis Locus AT1G75720

Position : Chr1 ( 5`- 28434568 .. 28435489 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75720

Protein [Map View]
METTKRAEIDTTAPFRTVKEAVALFGERVLASQVYSNHLKVAMKIQMHDEKWEDPSGIKIELQETRYDLKRAKEESIQMR
NSLSCLKEELERTKQELQKLRVDPGVNETKLDETVFKTKFEVLVPRVDDEPIRSPRLRSMSEKRYVKFANPTGNNGSVFL
ERHPSMKKKEKKTKDKKKKSLIPLFIGGIFSKKKVLQ*

DNA
ATGGAGACAACGAAGAGAGCAGAGATCGACACAACGGCACCGTTTAGAACCGTCAAAGAAGCCGTTGCTTTGTTCGGCGA
GAGAGTCTTAGCCAGTCAAGTCTACTCGAACCATCTCAAAGTGGCAATGAAGATACAGATGCATGATGAGAAATGGGAAG
ATCCATCAGGGATTAAGATAGAGCTTCAAGAGACAAGATATGATCTCAAAAGGGCAAAAGAAGAAAGCATACAAATGAGG
AACTCTTTGTCTTGTCTCAAGGAAGAGCTTGAACGAACAAAACAAGAGCTCCAGAAGCTGAGAGTTGATCCTGGGGTAAA
CGAAACGAAACTCGACGAGACTGTTTTTAAAACCAAGTTTGAAGTGTTAGTTCCTCGGGTTGATGATGAGCCAATTAGAA
GTCCGAGGTTGAGATCGATGAGTGAGAAGAGATACGTGAAATTTGCAAACCCTACTGGTAATAATGGCTCGGTGTTTCTT
GAGAGACATCCTTCAATGAAAAAGAAGGAGAAGAAGACAAAGGATAAGAAGAAGAAGAGTTTAATCCCTTTGTTTATTGG
AGGGATTTTTTCTAAGAAAAAGGTTTTGCAATGA