Details for Arabidopsis Locus AT1G75717

Position : Chr1 ( 5`- 28433919 .. 28434261 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75717

Protein [Map View]
MKLFHKLGKILMRLIDFTLHSSSRRQKKNNSRSGDGERFEPPKISCSSSYYSSHVHYSEAIADCIEFFNKSSAMSCEDHE
ARLVNNIDRDCYYV*

DNA
ATGAAGCTCTTCCACAAATTAGGAAAGATCCTCATGAGGCTCATTGATTTCACTCTTCATTCCTCCTCTCGCCGGCAGAA
GAAGAACAACTCCCGCTCCGGCGATGGAGAAAGGTTTGAGCCGCCGAAGATTTCGTGTAGTAGTTCGTACTATTCGTCTC
ACGTACACTACAGTGAAGCTATCGCAGATTGCATAGAGTTTTTCAACAAGTCTTCTGCTATGTCTTGTGAAGATCATGAA
GCTCGCCTTGTTAACAATATCGATCGTGACTGTTATTACGTTTAG