Details for Arabidopsis Locus AT1G75710

Position : Chr1 ( 5`- 28428706 .. 28431249 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75710

Protein [Map View]
MALLTFLPENAEAPQKHKPTSSKRKKRDNPTDQTQTQKHKPQKPKKAVPPKQPSSWDQIKNLLTCKQIEGSRVHDPSKNS
QSGPSMTTNLSPSKLGSSCSSICSFRDVAHGNTRVVHRADHSPDVGNSATPNSETRLLTRKPGQHGSSSSRSLTSGSTRS
NASGSYTSSSTTSFRAMQFRKLSGCYECHMIVDPSRYPISPRVCACSQCGEVFPKLESLELHQAVRHAVSELGPEDSGRN
IVEIIFKSSWLKKDSPICQIERILKVHNTQRTIQRFEDCRDAVKARALQATRKDARCAADGNELLRFHCTTLTCSLGARG
SSSLCSNLPVCGVCTVIRHGFQGKSGGGGANVANAGVRTTASSGRADDLLRCSDDARRVMLVCRVIAGRVKRVDLPAADA
SATAEKKSTVEDNSVVGVSSSGGTFDSVAVNAGVYSNLEELVVYNPRAILPCFVVIYKVLES*

DNA
ATGGCTTTACTAACTTTCTTGCCGGAGAACGCAGAGGCGCCACAAAAACACAAGCCAACGTCTAGCAAACGAAAGAAACG
CGATAATCCCACCGACCAAACGCAGACACAGAAACATAAACCGCAGAAACCGAAGAAAGCAGTACCTCCGAAGCAGCCAT
CTTCATGGGACCAAATCAAGAACCTATTGACTTGCAAACAAATCGAAGGGTCAAGAGTCCATGATCCTTCCAAGAACTCT
CAATCTGGTCCGTCCATGACAACTAACTTATCTCCTTCCAAGCTTGGCTCGTCGTGCAGCTCCATTTGCAGCTTTAGAGA
CGTGGCTCACGGCAACACTCGTGTGGTTCATAGAGCTGATCACTCACCAGACGTAGGTAACTCGGCTACTCCTAACTCGG
AGACTCGGCTTCTGACTCGGAAACCTGGTCAACACGGTTCTTCTTCGTCTCGGTCTCTTACATCTGGCTCAACGAGATCT
AACGCCAGTGGGAGTTACACGTCATCGTCAACGACTTCGTTTAGAGCCATGCAGTTCCGTAAACTCTCCGGATGTTACGA
ATGTCACATGATCGTTGACCCGAGCAGGTATCCGATTTCGCCTAGGGTTTGTGCTTGTTCCCAATGTGGAGAAGTTTTCC
CCAAGCTTGAAAGCTTAGAGCTTCATCAAGCAGTTCGTCACGCAGTTTCGGAGTTAGGTCCGGAGGATTCGGGTCGAAAC
ATAGTGGAGATCATATTCAAATCAAGCTGGCTTAAAAAAGACAGTCCCATCTGTCAGATCGAACGGATATTAAAAGTCCA
CAACACTCAACGTACGATCCAACGGTTTGAGGATTGCCGAGACGCAGTGAAGGCGCGTGCACTTCAAGCAACCAGAAAAG
ATGCTCGTTGTGCCGCCGACGGCAACGAGCTCTTACGTTTTCACTGCACCACTCTCACTTGTTCACTCGGAGCTCGTGGC
TCTTCTTCTCTCTGCTCTAACCTCCCTGTTTGTGGCGTCTGCACCGTGATTCGCCACGGTTTCCAAGGAAAATCTGGTGG
CGGAGGAGCCAACGTCGCAAACGCCGGTGTGAGGACGACGGCGAGCAGCGGAAGAGCTGATGATTTGCTGAGGTGTAGCG
ATGATGCGAGGAGAGTGATGCTTGTGTGCCGTGTGATCGCTGGGAGAGTTAAGCGAGTTGATTTACCGGCGGCGGATGCT
TCGGCTACAGCGGAGAAGAAGTCAACGGTGGAGGATAACTCGGTGGTTGGAGTTTCTTCGAGTGGTGGTACGTTTGACTC
GGTGGCGGTCAATGCTGGAGTTTATTCGAATCTTGAGGAGCTTGTGGTTTATAACCCGAGAGCTATATTACCTTGCTTCG
TGGTTATTTACAAAGTTTTAGAATCTTGA