Details for Arabidopsis Locus AT1G75700

Position : Chr1 ( 5`- 28423896 .. 28424931 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75700

Protein [Map View]
MIGSFLTRGLLMVFGYAYPAYECFKTVELNKPEIQQLQFWCQYWIIVAALTIFERIGDALVSWLPMYSEAKLAFFIYLWF
PKTKGTTYVYDSFFRPYIAKHENEIDRNLVKVKTRAKDMAMIYLQKAINQGQTKFFEILQYITEQSTPKSKAEEKKETTI
PKLDDPILKVKENEVTK*

DNA
ATGATTGGATCGTTTCTGACAAGAGGGCTTTTAATGGTGTTTGGATATGCATATCCTGCTTATGAGTGCTTCAAAACGGT
CGAACTCAACAAGCCTGAAATTCAACAACTTCAGTTCTGGTGCCAGTATTGGATTATTGTAGCTGCTTTGACGATTTTCG
AAAGAATTGGTGATGCTCTTGTTTCTTGGTTACCAATGTATAGCGAGGCGAAGTTGGCTTTCTTCATTTATCTCTGGTTT
CCAAAGACTAAAGGAACAACATACGTTTACGATTCTTTCTTCAGGCCATATATAGCAAAGCATGAAAATGAAATTGACCG
CAACTTGGTGAAGGTAAAGACTAGAGCTAAGGATATGGCAATGATATATCTCCAAAAAGCAATCAACCAAGGGCAGACCA
AATTCTTTGAGATCTTACAGTATATCACAGAACAATCAACACCAAAATCTAAGGCTGAGGAAAAGAAAGAGACAACAATA
CCTAAACTCGATGATCCAATTCTTAAGGTGAAAGAAAACGAAGTCACTAAATGA