Details for Arabidopsis Locus AT1G75640

Position : Chr1 ( 5`- 28403466 .. 28407051 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75640

Protein [Map View]
MAATVIFFLHFAAIFFSRFHHTSAISSETQALTSFKLSLHDPLGALESWNQSSPSAPCDWHGVSCFSGRVRELRLPRLHL
TGHLSPRLGELTQLRKLSLHTNDINGAVPSSLSRCVFLRALYLHYNSFSGDFPPEILNLRNLQVLNAAHNSLTGNLSDVT
VSKSLRYVDLSSNAISGKIPANFSADSSLQLINLSFNHFSGEIPATLGQLQDLEYLWLDSNQLQGTIPSALANCSSLIHF
SVTGNHLTGLIPVTLGTIRSLQVISLSENSFTGTVPVSLLCGYSGYNSSMRIIQLGVNNFTGIAKPSNAACVNPNLEILD
IHENRINGDFPAWLTDLTSLVVLDISGNGFSGGVTAKVGNLMALQELRVANNSLVGEIPTSIRNCKSLRVVDFEGNKFSG
QIPGFLSQLRSLTTISLGRNGFSGRIPSDLLSLYGLETLNLNENHLTGAIPSEITKLANLTILNLSFNRFSGEVPSNVGD
LKSLSVLNISGCGLTGRIPVSISGLMKLQVLDISKQRISGQLPVELFGLPDLQVVALGNNLLGGVVPEGFSSLVSLKYLN
LSSNLFSGHIPKNYGFLKSLQVLSLSHNRISGTIPPEIGNCSSLEVLELGSNSLKGHIPVYVSKLSLLKKLDLSHNSLTG
SIPDQISKDSSLESLLLNSNSLSGRIPESLSRLTNLTALDLSSNRLNSTIPSSLSRLRFLNYFNLSRNSLEGEIPEALAA
RFTNPTVFVKNPGLCGKPLGIECPNVRRRRRRKLILLVTLAVAGALLLLLCCCGYVFSLWKWRNKLRLGLSRDKKGTPSR
TSRASSGGTRGEDNNGGPKLVMFNNKITLAETLEATRQFDEENVLSRGRYGLVFKATFRDGMVLSVRRLMDGASITDATF
RNQAEALGRVKHKNITVLRGYYCGPPDLRLLVYDYMPNGNLATLLQEASHQDGHVLNWPMRHLIALGIARGLSFLHSLSI
IHGDLKPQNVLFDADFEAHLSEFGLDRLTALTPAEEPSTSSTPVGSLGYIAPEAGLTGETSKESDVYSFGIVLLEILTGK
KAVMFTEDEDIVKWVKRQLQKGQIVELLEPGLLELDPESSEWEEFLLGIKVGLLCTGGDVVDRPSMADVVFMLEGCRVGP
AISLSADPTSPTSPAATAVS*

DNA
ATGGCCGCAACGGTCATTTTCTTCCTTCACTTCGCCGCAATCTTCTTCTCCAGATTCCACCACACCTCCGCCATCTCATC
AGAGACTCAAGCACTCACATCTTTCAAACTCTCTCTCCACGACCCTCTAGGAGCTCTCGAGTCCTGGAATCAATCATCTC
CATCAGCTCCATGCGACTGGCACGGCGTTTCTTGCTTCTCCGGCCGTGTCCGTGAGCTTCGTCTTCCTCGTCTCCACCTC
ACCGGCCACCTCAGTCCTCGACTCGGTGAGTTGACTCAGCTCCGTAAACTAAGTCTTCACACCAACGACATAAACGGCGC
CGTTCCTTCGTCTCTCTCTCGTTGTGTCTTCCTTAGAGCTCTTTATCTTCACTACAACTCCTTCTCCGGCGATTTTCCAC
CGGAGATACTGAATCTACGAAACCTCCAGGTCCTCAACGCTGCTCACAACTCACTCACCGGAAATCTATCCGACGTCACA
GTCTCGAAGAGCCTTCGTTACGTCGATTTGTCTTCCAATGCAATATCCGGTAAGATTCCGGCGAATTTCTCAGCGGATTC
ATCTCTCCAGCTCATCAACCTCTCGTTCAACCACTTCTCCGGTGAGATCCCGGCTACATTGGGACAACTACAAGACCTCG
AGTATCTCTGGCTAGACTCAAACCAATTACAAGGCACAATACCATCCGCATTAGCCAACTGTTCATCGCTTATACACTTC
AGCGTAACCGGTAATCACCTCACCGGTTTAATTCCGGTTACTTTAGGCACGATTCGAAGCCTGCAGGTGATTTCATTATC
GGAGAATTCATTTACCGGTACAGTTCCGGTTAGTCTTCTATGTGGTTATTCAGGTTACAATTCCTCCATGCGAATCATTC
AATTAGGAGTTAATAACTTCACGGGAATAGCTAAGCCGTCAAATGCAGCTTGCGTGAACCCTAATTTGGAGATTCTCGAC
ATTCACGAGAATCGCATTAATGGCGATTTTCCCGCGTGGTTGACTGATTTGACCTCTTTAGTGGTTTTGGATATTTCTGG
AAACGGTTTCTCCGGTGGTGTTACGGCTAAAGTTGGGAACTTGATGGCGCTTCAGGAGCTGAGAGTAGCTAACAATTCAC
TTGTTGGAGAAATTCCGACGAGTATCCGTAATTGCAAATCGTTAAGAGTCGTTGATTTCGAAGGAAACAAGTTCTCGGGT
CAGATTCCGGGTTTTCTAAGTCAGTTACGGAGCCTGACAACGATATCTCTTGGAAGAAACGGGTTCTCGGGTCGGATTCC
ATCGGATCTTCTCAGCTTGTACGGACTCGAGACATTGAATCTCAATGAAAATCATCTCACCGGAGCAATACCGTCGGAGA
TAACAAAGCTAGCTAATCTTACCATCCTTAATCTCAGTTTCAACAGATTCTCCGGCGAAGTTCCGTCCAATGTGGGTGAT
CTGAAAAGCTTGAGTGTTCTCAACATAAGTGGATGCGGGTTAACGGGTCGGATACCGGTTAGCATTAGCGGATTAATGAA
GCTTCAGGTTTTGGATATAAGTAAACAGAGAATCTCTGGTCAGTTACCAGTCGAACTATTTGGTTTACCGGATCTTCAAG
TGGTTGCTCTTGGAAACAACTTGCTCGGCGGCGTCGTACCGGAAGGTTTCAGCAGCTTGGTTAGTCTTAAGTACTTAAAT
CTCAGTTCCAACTTATTCTCCGGACATATCCCAAAGAACTATGGATTTCTCAAGTCATTACAAGTGCTTTCGTTGTCTCA
CAATCGAATATCCGGTACAATCCCGCCGGAGATTGGGAATTGTTCCAGTCTTGAGGTTCTTGAGCTTGGTTCTAATAGTT
TAAAGGGTCACATTCCGGTTTACGTTTCCAAGTTGTCTCTTTTGAAGAAGCTTGATTTGAGTCACAACAGTTTAACAGGG
AGTATTCCGGATCAGATTTCTAAGGATTCTTCTCTAGAATCTCTCCTGCTTAATTCGAATTCTCTATCGGGTCGAATACC
GGAATCTTTATCAAGATTGACGAATCTAACCGCGTTGGATCTTTCGTCGAACAGATTGAATTCCACTATACCATCAAGTC
TCTCTCGGCTTCGTTTCTTGAACTATTTCAACTTATCAAGAAACAGTTTGGAAGGGGAGATTCCAGAAGCTCTAGCTGCG
CGTTTCACTAACCCGACCGTCTTTGTCAAGAACCCGGGACTCTGCGGTAAACCGCTTGGTATAGAATGTCCAAACGTTCG
AAGGAGAAGAAGAAGAAAGCTAATTCTACTAGTGACACTAGCAGTGGCTGGAGCTTTGTTGCTGTTACTCTGTTGTTGTG
GTTATGTGTTCAGTTTATGGAAATGGCGGAACAAACTAAGATTGGGCTTGAGTCGGGACAAGAAAGGGACCCCCTCACGT
ACATCTAGAGCGAGTTCTGGTGGGACAAGAGGAGAAGACAACAATGGTGGACCTAAACTTGTGATGTTCAACAACAAGAT
CACGTTAGCTGAAACCTTAGAAGCCACAAGACAATTTGACGAAGAGAACGTATTGAGCAGAGGAAGGTATGGGTTGGTCT
TCAAGGCGACGTTTAGAGATGGGATGGTTCTATCGGTTCGTAGACTAATGGATGGTGCTTCGATAACCGATGCAACGTTC
CGTAACCAAGCTGAGGCTTTAGGTAGAGTGAAGCACAAGAACATCACGGTCTTGAGAGGTTATTACTGCGGACCACCTGA
TCTAAGACTTCTTGTTTACGACTACATGCCCAACGGAAACCTCGCTACGCTTTTGCAAGAAGCCTCTCACCAAGACGGAC
ATGTCTTGAACTGGCCAATGCGTCATCTCATTGCTCTTGGAATCGCTAGAGGACTGTCCTTCTTGCATTCTTTATCAATC
ATTCACGGCGATCTTAAACCGCAAAACGTACTCTTCGACGCTGACTTTGAAGCGCATTTGTCAGAATTCGGGTTAGATAG
ATTGACAGCGTTGACTCCAGCTGAAGAACCATCCACTTCATCCACTCCCGTCGGGTCTTTAGGCTACATTGCACCGGAAG
CGGGTTTAACGGGTGAAACAAGTAAAGAGAGCGACGTGTACAGCTTCGGGATCGTGTTGTTAGAGATCTTAACGGGGAAA
AAGGCAGTGATGTTTACAGAGGATGAAGATATAGTGAAATGGGTGAAGAGACAGTTACAAAAAGGTCAGATCGTTGAGTT
GCTTGAACCGGGTTTGTTGGAGCTTGACCCGGAAAGTTCGGAGTGGGAAGAGTTCTTGTTAGGGATCAAAGTTGGGTTGT
TGTGTACTGGAGGAGACGTCGTTGATCGTCCGTCTATGGCTGATGTTGTTTTCATGCTCGAAGGGTGTAGAGTCGGTCCG
GCGATTTCCTTGTCCGCCGATCCTACTTCACCTACTTCTCCCGCCGCAACCGCCGTTTCTTGA