Details for Arabidopsis Locus AT1G75560

Position : Chr1 ( 5`- 28371141 .. 28373241 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75560

Protein [Map View]
MSSMSRSRSRSRSRSRDRFRSRSPRDRRMRSERVSYHDAPSRREREPRRAFSQGNLCNNCKRPGHFARDCSNVSVCNNCG
LPGHIAAECTAESRCWNCREPGHVASNCSNEGICHSCGKSGHRARDCSNSDSRAGDLRLCNNCFKQGHLAADCTNDKACK
NCRTSGHIARDCRNDPVCNICSISGHVARHCPKGDSNYSDRGSRVRDGGMQRGGLSRMSRDREGVSAMIICHNCGGRGHR
AYECPSARVADRGFRRY*

DNA
ATGAGTTCAATGAGCAGAAGCAGAAGTCGAAGTAGAAGTCGTAGTCGGGATCGGTTTCGTAGTCGGAGTCCGAGAGACAG
GAGAATGAGATCTGAACGAGTTTCTTACCATGATGCTCCTTCTAGAAGGGAGAGGGAGCCACGTCGTGCCTTCAGCCAAG
GAAATCTCTGCAACAACTGCAAGCGACCTGGTCACTTTGCAAGAGACTGTTCTAATGTTTCCGTCTGTAACAACTGTGGT
CTTCCAGGGCACATTGCAGCAGAATGCACTGCGGAATCACGTTGTTGGAACTGTAGAGAACCGGGCCACGTAGCCTCAAA
CTGTTCAAACGAAGGAATCTGCCACTCCTGTGGTAAATCTGGACATCGAGCCAGAGACTGCTCTAATTCGGATTCTCGTG
CAGGAGACTTAAGGCTCTGCAACAACTGCTTCAAACAGGGACATCTTGCCGCTGACTGCACAAATGACAAGGCGTGCAAG
AACTGCAGGACTTCAGGTCACATAGCTCGCGATTGCAGGAACGATCCAGTTTGTAACATCTGCAGTATCTCGGGGCATGT
TGCTAGACACTGCCCAAAGGGTGACAGCAATTACTCTGACAGAGGAAGCAGGGTTCGAGATGGTGGTATGCAAAGAGGTG
GTTTGAGCAGAATGAGCAGAGACAGAGAAGGCGTTAGTGCTATGATAATATGTCACAATTGTGGTGGCCGAGGACACAGG
GCGTACGAGTGTCCGTCTGCTCGAGTCGCTGACCGTGGATTCCGCCGGTACTGA