Details for Arabidopsis Locus AT1G75540

Position : Chr1 ( 5`- 28366027 .. 28367652 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75540

Protein [Map View]
MKIRCDVCDKEEASVFCTADEASLCGGCDHQVHHANKLASKHLRFSLLYPSSSNTSSPLCDICQDKKALLFCQQDRAILC
KDCDSSIHAANEHTKKHDRFLLTGVKLSATSSVYKPTSKSSSSSSSNQDFSVPGSSISNPPPLKKPLSAPPQSNKIQPFS
KINGGDASVNQWGSTSTISEYLMDTLPGWHVEDFLDSSLPTYGFSKSGDDDGVLPYMEPEDDNNTKRNNNNNNNNNNNTV
SLPSKNLGIWVPQIPQTLPSSYPNQYFSQDNNIQFGMYNKETSPEVVSFAPIQNMKQQGQNNKRWYDDGGFTVPQITPPP
LSSNKKFRSFW*

DNA
ATGAAGATCAGGTGCGACGTCTGCGATAAAGAAGAAGCGTCGGTGTTTTGCACGGCCGACGAAGCATCTCTCTGCGGCGG
CTGCGACCACCAAGTCCACCACGCTAACAAACTCGCCTCTAAACATCTCCGTTTCTCTCTCCTTTATCCTTCTTCTTCCA
ACACCTCCTCTCCTCTCTGCGACATCTGTCAGGATAAAAAAGCTCTGTTGTTCTGTCAACAAGATAGAGCTATTTTATGC
AAAGATTGCGATTCATCGATCCACGCTGCGAACGAACACACAAAGAAACACGATAGGTTTCTTCTTACAGGGGTTAAGCT
CTCTGCAACATCGTCTGTTTACAAACCTACTTCGAAATCTTCTTCTTCTTCTTCAAGCAACCAAGATTTCTCTGTCCCTG
GATCATCAATCTCTAATCCTCCTCCTCTCAAGAAACCTCTCTCAGCTCCTCCTCAGAGCAACAAGATCCAACCCTTTTCG
AAGATCAACGGCGGTGATGCGTCGGTGAATCAGTGGGGATCCACAAGCACGATTTCTGAGTATTTGATGGATACGTTACC
TGGTTGGCACGTTGAGGATTTCCTCGATTCCTCTCTTCCTACTTATGGTTTCTCTAAGAGTGGTGATGATGATGGAGTGT
TACCATATATGGAACCAGAAGATGACAACAACACTAAGAGAAACAACAACAACAACAACAACAACAACAACAATACAGTG
TCACTTCCATCTAAGAATTTAGGGATTTGGGTCCCTCAGATTCCACAAACTCTTCCTTCTTCATACCCAAATCAATACTT
TTCTCAAGACAACAACATACAGTTTGGGATGTACAACAAAGAAACATCACCAGAAGTAGTGTCTTTTGCTCCAATACAAA
ACATGAAACAACAAGGACAGAACAACAAGAGATGGTATGATGATGGTGGCTTCACTGTCCCACAGATCACTCCTCCTCCT
CTTTCTTCTAATAAAAAGTTTAGATCTTTCTGGTAA