Details for Arabidopsis Locus AT1G75440

Position : Chr1 ( 5`- 28313487 .. 28315122 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75440

Protein [Map View]
MSSSGAPSRKTLSKIATNRLQKELVEWQMNPPTGFKHKVTDNLQRWIIEVIGAPGTLYANDTYQLQVDFPEHYPMESPQV
IFLHPAPLHPHIYSNGHICLDILYDSWSPAMTVSSICISILSMLSSSTEKQRPTDNDRYVKNCKNGRSPKETRWWFHDDK
V*

DNA
ATGTCAAGTTCTGGTGCTCCTTCACGCAAGACTCTGAGTAAGATCGCGACTAATCGTCTTCAGAAAGAGCTTGTGGAATG
GCAGATGAATCCACCTACTGGTTTCAAACACAAAGTCACTGATAATCTCCAAAGATGGATAATTGAAGTTATTGGAGCTC
CAGGAACTCTATATGCCAACGATACTTATCAGCTTCAAGTTGATTTTCCAGAACATTATCCTATGGAATCGCCACAAGTG
ATTTTTCTTCATCCAGCTCCTCTGCATCCTCACATTTACAGCAATGGGCATATTTGTCTAGATATTTTGTATGATTCGTG
GTCTCCAGCCATGACGGTGAGTTCTATCTGCATTAGCATCCTCTCCATGCTCTCAAGCTCGACTGAAAAGCAACGACCAA
CCGATAATGACCGATATGTGAAGAATTGTAAGAACGGAAGATCTCCAAAGGAGACCCGATGGTGGTTCCACGACGATAAA
GTATAA