Details for Arabidopsis Locus AT1G75400

Position : Chr1 ( 5`- 28296919 .. 28299686 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75400

Protein [Map View]
MGSVCCVAVKDRKVPPSGGPASSSVHRNSACSPQWSFRRDNRRRVADEIEGSPYYSPYVASRGISMDKMSLGSERGTLSE
GGTPPDGHLGTPASQKSATPEMSTNSMVPPSSGSSLASSDLIEVKNLVDSPGIVPSAQSKPLFSTPSLPNPVSDLSSAHT
RLLPPKSTPSRRARRSPGHQLFRQVSDSQILGLKSPINNYSISEGRSSFVLSTCSNDFATGSQYASSEGGWSMNTFSELV
AYSQRDRWSFDSEHLGSGRRKLSGGSSRFSFSPSVVDQQVCGACSKLLTERSSIATFELPIAAVLACGHVYHAECLETMT
TDIEKYDPACPICTIGEKRVAKITRKALKAEAEAKAKQYKRCKNRVVDSYGESECDEFVFQKMGKREGKALKLEASCSSK
SSSNKSFLKWHFASISSKWNKPSSKDSALKKGFWSRHRNNRSSSSIEGLNQTSPL*

DNA
ATGGGTTCAGTTTGTTGTGTAGCTGTGAAAGACAGAAAGGTTCCTCCTAGTGGTGGACCTGCGAGTTCATCTGTTCATCG
GAATTCAGCATGTTCGCCACAATGGAGTTTTCGACGTGATAATAGGAGGCGAGTGGCTGATGAGATTGAGGGTTCACCTT
ATTACAGTCCTTATGTTGCGAGTAGAGGTATTAGTATGGATAAGATGTCATTAGGCTCTGAGAGAGGAACTTTATCTGAA
GGAGGAACCCCTCCTGATGGACATTTAGGGACTCCTGCTTCTCAGAAATCAGCAACTCCGGAAATGAGCACCAATTCCAT
GGTTCCACCTTCTTCAGGTTCATCCTTGGCAAGCAGTGATCTCATTGAGGTGAAGAACTTAGTTGACTCACCTGGAATTG
TCCCTTCAGCTCAATCGAAGCCTTTGTTCTCCACGCCTTCTCTTCCCAATCCAGTTAGTGATCTTTCATCGGCTCACACG
CGTTTGCTTCCTCCTAAATCCACACCATCAAGACGGGCTCGGCGTTCACCTGGGCATCAGTTGTTTAGGCAGGTTTCTGA
TAGTCAAATTTTAGGACTGAAATCCCCAATTAATAATTACTCAATCTCAGAAGGAAGGTCGTCCTTTGTGCTTTCGACCT
GTAGCAATGACTTCGCCACTGGATCCCAGTACGCATCTTCTGAAGGTGGCTGGTCTATGAACACTTTTTCTGAGCTCGTG
GCATATTCTCAAAGGGATAGATGGTCCTTTGATAGCGAACACTTGGGTTCTGGCAGACGGAAACTAAGTGGTGGTAGCAG
CAGATTCTCATTCTCCCCTTCCGTTGTTGATCAGCAGGTTTGTGGAGCTTGTTCAAAGTTGCTAACCGAGAGGTCTTCTA
TAGCCACTTTTGAGCTCCCAATCGCTGCTGTTCTTGCCTGTGGTCATGTTTACCACGCAGAGTGCTTAGAGACCATGACT
ACTGATATAGAGAAGTATGATCCTGCTTGTCCCATATGCACAATTGGGGAGAAACGGGTTGCGAAAATAACAAGGAAAGC
CCTAAAAGCGGAGGCGGAAGCAAAGGCAAAGCAGTACAAAAGATGTAAAAACCGTGTGGTAGATAGTTACGGTGAGAGTG
AATGCGATGAGTTTGTATTCCAGAAAATGGGGAAACGAGAAGGCAAAGCTCTCAAGCTGGAAGCTAGTTGCAGTAGCAAG
AGCTCGTCTAATAAGTCATTCTTGAAATGGCACTTTGCTTCTATCAGCTCCAAGTGGAATAAACCCTCGTCCAAAGACTC
TGCATTGAAGAAGGGATTCTGGTCTAGACATCGAAATAACCGGTCTTCTTCAAGCATAGAGGGACTTAATCAGACATCTC
CGCTATGA