Details for Arabidopsis Locus AT1G75388

Position : Chr1 ( 5`- 28291698 .. 28293008 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75388

Protein [Map View]
MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS*

DNA
ATGTCTCCGGTGATTAGTGAAATCCTTAGATCTGGTTTAACTATAGACTCGTCTCTTAGACGCAGGACCCATCTTGTTCA
ATCTTTCTCCGTCGTCTTTCTCTACTGGTTCTATGTTTTCTCATAA