Details for Arabidopsis Locus AT1G75310

Position : Chr1 ( 5`- 28261004 .. 28266124 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75310

Protein [Map View]
MEYEKSPTATTFSRKISNNRSHSLSFSANAVYDGVFSSPVNSKSPLVDYGEIFRGSGPSPSSIPFLDVPELNVGKVKVDV
RSSKLDYSSVFGGLGACDFAVTPKEVIIKSEKKTSINEDKKRNRRKGGNSSDVPLCNEGKKSPEMVRMKHSDISYHQTVP
RNENGATHLTQVPATMPGPIPTQVVDNTSLLHKIESKSTPIPAVEKKLPCNEGREEVKASRKQGSKTEVDFENIFARDGC
STRDDSTCKTVSNGEYRDVKPPSSFQCTLNGEHGASERLSGLNSGPSERYETEDADSPSSPPYFDAETDENSVAAESSAA
LKKAIEEAQIRMNIAKQMMEKKKSGFRSCAKLKSCDDSKIENKGNTKVEGITEESRDNNSQILGEMVKPSEQSFSNEGDQ
HAKRARKLWGVPEGLLKSTSDHKPEELEEQDIITLEEEQARRGRKHWELPGGIFKSVMNSKQQEPENLAPAKPEPDTKQE
VQPITENPFYTFGQLGSKLKCVVEAFTGSKVSQKDEKQFTEKENSTVTQMVQDEESDSQEMLAGIPVIETYLREVEETPQ
QTESKSEMNIEEKSESTICAFTERSSQNMEKETGWQVKSACKFEDGSGVKDFQENGDHTCNVLDQEGEKEIVSEPQEMLV
GPDDSKTYVREVEETPTPSLNKTQSDDSVGAMVSFNRVNISEPGNIDEVQEAVHKVPRRRRVWKTSEDVYNMIKAPKGNN
RPWQLESAENETTAMSFHEEGVRIHHASEEIESTSGQASDSGLQENWTVLKQMFRQMFQTADTKGEDETYCLVESERGHL
DIHQKAQEKYEQVEVETVRTNYEAYAHTRENEDESAQETYCRKEDGKVEVQGKTSLVRELIGEELEMASLEEEDVQEASE
EAGWVQGLSELNEINEHADSHAEMLEYDRSETDSNNSRERFDQTQEQAEETMIDGSIDTDTSRSSFEMRQGDSYIEEVGI
EQHRSDQFPEKASAVSNTEEHIEEIDSDSIQSGWSVVEDDDRSLQDGGASQAESKHDELEETKEESDEMKTSLGVERNGD
KKELEHQFECQENETYRSNVEAAESSCRFPNGEEIIGAATNGNMKENEGEEGEESCRSSMEEEGDATSDIGAATDGNMKE
NEGEESCRSSMEEEGDATSDISQNKAETVEEHLKKIDETREKERERKQERVMVERAIREARERAFADAMERAGKTAMEKA
KAVAHRREVPRKSEKGSVEVNDKLSSAEKASMQAKLRAERAAVERAITEVRERAMEKALSGKSAASQAKSYGGSKSFSSS
GERRGSSSSGTENKSSGPSNSSNQTGEPIQRCKARSERHQRTSDRAAEALAEKKLRDLKTQKEQTERNRLAEALDADVKR
WSSGKENNLRALISTLQYILGAESGWKPIPLTDLVSSASVRKAYRKATLYVHPDKLQQRGASTQQKYICEKVFDLLKEAW
NKFGADER*

DNA
ATGGAGTATGAGAAATCTCCCACTGCTACTACTTTCTCTAGGAAGATTAGTAATAATCGTAGCCATAGTCTTAGCTTTAG
TGCAAATGCCGTATACGACGGAGTTTTTTCTTCTCCGGTGAATTCGAAATCTCCTTTAGTTGATTACGGTGAGATTTTCC
GAGGTTCAGGTCCTTCTCCGTCTTCGATTCCGTTTCTGGATGTTCCGGAGCTGAACGTTGGTAAGGTTAAGGTCGATGTT
CGGAGTTCTAAGCTCGATTACTCTTCGGTGTTTGGTGGCTTAGGAGCTTGCGATTTTGCTGTTACTCCTAAGGAGGTGAT
CATCAAGTCCGAGAAGAAAACCTCCATTAACGAGGATAAGAAAAGGAATCGTAGGAAAGGTGGAAATTCTTCTGATGTTC
CTCTTTGCAACGAGGGGAAAAAATCACCTGAAATGGTTAGGATGAAGCACTCTGATATATCATATCACCAGACGGTCCCT
CGTAATGAGAATGGGGCTACTCATCTTACTCAGGTCCCTGCTACTATGCCTGGTCCTATTCCGACTCAAGTGGTTGATAA
TACGAGTTTGTTGCACAAGATTGAAAGTAAATCAACTCCTATTCCAGCAGTTGAGAAGAAGCTGCCATGTAACGAGGGTC
GTGAGGAAGTCAAGGCTTCTAGAAAGCAGGGATCTAAAACTGAGGTTGATTTTGAGAACATTTTTGCTCGAGATGGATGC
AGTACGCGTGATGACTCCACGTGTAAGACCGTTTCTAATGGTGAATATCGGGATGTGAAACCGCCTTCAAGCTTTCAGTG
TACATTGAATGGTGAACATGGAGCTTCTGAAAGGTTATCGGGTTTAAATTCTGGGCCTTCGGAAAGGTATGAAACTGAAG
ATGCTGATTCTCCAAGTTCACCTCCATACTTCGATGCTGAAACAGATGAAAATTCGGTTGCCGCTGAGTCTTCTGCAGCA
CTGAAAAAGGCTATAGAAGAGGCTCAAATAAGAATGAATATTGCAAAACAAATGATGGAAAAGAAAAAGTCCGGCTTTCG
CAGTTGTGCAAAACTGAAATCTTGTGATGACTCTAAAATTGAGAATAAAGGGAACACAAAGGTTGAAGGAATTACAGAAG
AAAGCAGAGACAACAATTCTCAGATTCTCGGTGAAATGGTGAAACCTTCTGAACAATCATTTTCAAACGAGGGAGATCAG
CATGCTAAAAGAGCGCGGAAGCTGTGGGGAGTTCCTGAAGGACTTTTAAAATCAACTTCAGACCATAAGCCAGAAGAGTT
AGAAGAGCAAGATATCATAACGCTAGAAGAGGAACAAGCACGAAGAGGTCGAAAACACTGGGAATTACCTGGAGGGATAT
TCAAATCAGTTATGAATAGTAAGCAGCAGGAGCCAGAAAACCTTGCACCAGCTAAACCTGAACCTGATACGAAACAAGAG
GTGCAACCAATAACTGAGAATCCCTTCTATACATTTGGACAGCTTGGCAGTAAATTAAAGTGTGTTGTAGAGGCCTTCAC
GGGGAGCAAAGTTTCACAAAAGGATGAGAAACAGTTTACAGAGAAGGAAAATTCTACCGTCACTCAAATGGTTCAAGATG
AGGAAAGTGACTCACAAGAGATGCTAGCTGGTATTCCAGTCATAGAAACATACTTAAGGGAAGTGGAAGAGACCCCACAA
CAAACTGAGAGTAAGAGCGAAATGAATATTGAAGAGAAGTCTGAATCAACCATATGTGCTTTCACAGAAAGGTCTTCTCA
GAATATGGAGAAAGAAACAGGATGGCAAGTTAAAAGTGCTTGCAAGTTCGAAGATGGATCTGGGGTAAAAGATTTCCAAG
AAAATGGTGACCACACTTGCAATGTTCTAGATCAGGAAGGTGAGAAGGAGATAGTCTCTGAGCCACAGGAGATGTTAGTT
GGTCCTGATGATTCCAAAACATATGTAAGGGAAGTGGAAGAAACCCCAACACCGAGTTTGAATAAAACTCAGTCCGATGA
TAGTGTTGGAGCTATGGTGTCTTTTAACAGAGTAAATATTTCTGAGCCAGGAAACATAGATGAGGTGCAAGAGGCAGTGC
ACAAGGTTCCCAGGCGAAGAAGAGTTTGGAAGACCTCTGAAGACGTCTATAATATGATAAAGGCTCCGAAGGGAAACAAC
AGGCCCTGGCAGCTAGAAAGTGCGGAAAATGAAACCACAGCGATGTCCTTTCATGAGGAAGGTGTAAGGATCCATCATGC
TAGCGAGGAAATAGAAAGCACATCTGGACAAGCTAGTGATTCAGGATTGCAAGAAAATTGGACCGTTCTTAAACAGATGT
TTAGGCAGATGTTTCAGACAGCAGATACTAAGGGAGAGGATGAAACTTACTGCTTAGTGGAATCTGAAAGGGGACATCTT
GATATCCATCAAAAAGCTCAAGAAAAATATGAACAGGTTGAGGTGGAGACAGTAAGAACGAATTATGAAGCCTATGCACA
TACCAGAGAAAATGAAGATGAGTCGGCACAAGAAACATATTGTAGAAAAGAGGATGGTAAGGTAGAAGTGCAAGGTAAAA
CGTCTTTGGTCCGTGAACTGATAGGAGAAGAACTAGAAATGGCTAGCCTAGAAGAAGAAGATGTGCAGGAAGCATCTGAA
GAAGCTGGCTGGGTTCAAGGACTTTCTGAACTTAATGAGATAAATGAGCATGCAGATTCTCATGCTGAAATGCTTGAATA
TGATCGAAGTGAAACAGATTCAAATAATTCTAGGGAGAGATTTGATCAAACACAGGAACAAGCAGAAGAAACTATGATCG
ATGGTAGTATAGATACTGACACCAGCAGGTCATCTTTTGAAATGAGACAAGGTGATTCATATATTGAGGAGGTTGGCATT
GAGCAACATCGCAGTGATCAATTCCCTGAAAAAGCTAGTGCTGTCAGTAACACGGAAGAACACATTGAAGAAATAGATTC
TGATTCGATTCAAAGTGGTTGGAGTGTTGTAGAGGATGACGACAGATCACTGCAGGATGGAGGGGCAAGTCAGGCAGAAA
GTAAGCATGACGAATTGGAGGAAACCAAAGAAGAAAGTGATGAAATGAAAACAAGTCTTGGTGTAGAGAGAAATGGAGAT
AAGAAAGAACTAGAGCACCAGTTTGAGTGTCAAGAGAATGAAACATATAGAAGCAATGTGGAGGCAGCTGAGTCTTCCTG
TCGTTTTCCAAACGGAGAAGAAATTATTGGCGCAGCAACAAATGGAAACATGAAAGAAAATGAGGGAGAGGAGGGAGAGG
AGAGTTGTCGATCATCTATGGAAGAAGAGGGAGATGCTACTTCTGATATTGGCGCAGCAACAGATGGAAACATGAAAGAA
AATGAGGGAGAGGAGAGTTGTCGATCATCTATGGAAGAAGAGGGAGATGCTACTTCTGATATTTCACAAAACAAAGCAGA
GACAGTTGAGGAACATCTGAAAAAGATAGATGAAACAAGAGAGAAAGAGAGAGAAAGAAAGCAAGAGAGAGTTATGGTAG
AAAGAGCTATTCGTGAAGCCCGCGAAAGGGCATTTGCTGATGCTATGGAAAGAGCAGGAAAAACTGCAATGGAGAAGGCA
AAGGCAGTAGCCCACCGTAGAGAGGTTCCAAGGAAATCAGAAAAGGGATCTGTTGAGGTAAACGATAAGTTATCATCAGC
TGAGAAGGCTTCAATGCAAGCCAAACTCAGAGCTGAGCGTGCTGCTGTAGAACGAGCAATCACTGAGGTCAGAGAACGTG
CCATGGAAAAAGCATTGTCTGGTAAGTCTGCTGCTTCTCAAGCAAAAAGTTATGGCGGCAGCAAGTCATTTAGCTCTTCT
GGTGAAAGACGAGGCTCCTCATCTTCTGGTACGGAGAACAAAAGTTCAGGTCCTTCCAATTCTTCAAACCAGACTGGTGA
ACCAATCCAGAGATGTAAAGCTAGATCTGAGAGACACCAGAGAACATCTGACCGCGCAGCAGAGGCTCTTGCAGAGAAGA
AACTTCGTGATCTTAAAACCCAGAAAGAGCAGACAGAGAGAAATAGACTCGCGGAAGCTCTTGATGCTGATGTCAAACGG
TGGTCGAGTGGAAAGGAAAACAACTTACGGGCGTTGATCTCAACACTCCAATATATACTTGGAGCAGAGAGTGGATGGAA
ACCGATTCCTCTCACTGATCTTGTCTCAAGCGCTTCTGTGAGAAAAGCCTACCGCAAGGCAACTCTTTATGTTCATCCCG
ACAAGCTTCAACAACGTGGCGCATCCACACAGCAGAAGTACATTTGTGAGAAAGTTTTTGACCTTCTCAAGGAAGCATGG
AACAAATTTGGTGCTGACGAACGATAA