Details for Arabidopsis Locus AT1G75250

Position : Chr1 ( 5`- 28244317 .. 28245501 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75250

Protein [Map View]
MASNSRSSISPWTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGRVPLPNYKTFESN
SRSINDFDTRYITKYLYMMLSIYFDNHSSDFEKFSQKVLVSYISLV*

DNA
ATGGCGTCAAACTCAAGAAGTTCAATCTCACCATGGACGTTTAGTCAAAACAAGATGTTCGAGAGGGCCTTGGCAGTTTA
CGACAAGGACACACCCGACCGATGGCACAATGTGGCAAAAGCTGTCGGAGGGAAAACTGTAGAAGAAGTGAAGCGCCACT
ATGACATTCTCGTCGAGGATCTCATCAACATCGAGACTGGTCGTGTCCCTTTGCCCAATTACAAGACCTTCGAATCTAAC
TCAAGAAGCATCAATGACTTTGACACAAGGTATATAACTAAATATCTATATATGATGCTCTCGATATATTTTGATAATCA
TTCTAGTGATTTTGAGAAATTCTCTCAAAAAGTTCTTGTAAGTTATATTTCTTTGGTTTAA