Details for Arabidopsis Locus AT1G75220

Position : Chr1 ( 5`- 28229157 .. 28232831 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75220

Protein [Map View]
MSFRDDNEEARNDLRRPFIHTGSWYRMGSRQSSMMGSSQVIRDSSISVLACVLIVALGPIQFGFTCGYSSPTQAAITKDL
GLTVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVP
VYIAEIAPQNMRGGLGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGILPCTLLIPGLFFIPESPRWLAKMGMTDEFETSL
QVLRGFETDITVEVNEIKRSVASSTKRNTVRFVDLKRRRYYFPLMVGIGLLVLQQLGGINGVLFYSSTIFESAGVTSSNA
ATFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISLVIVAAAFYLKEFVSPDSDMYSWLSILSVVGVVAMVVFFSL
GMGPIPWLIMSEILPVNIKGLAGSIATLANWFFSWLITMTANLLLAWSSGGTFTLYGLVCAFTVVFVTLWVPETKGKTLE
ELQSLFR*

DNA
ATGAGTTTCAGGGATGATAATGAGGAGGCTAGGAATGATTTGCGTCGGCCGTTTATTCACACCGGAAGCTGGTACCGGAT
GGGTTCGAGACAATCGAGTATGATGGGTTCCTCTCAAGTTATTCGAGACAGCTCTATCTCTGTTCTTGCATGTGTTTTGA
TCGTTGCTCTTGGCCCTATTCAATTCGGATTCACTTGTGGTTATTCATCTCCAACTCAAGCTGCAATCACCAAGGATCTC
GGTTTAACAGTATCTGAGTACTCTGTGTTTGGTTCTCTTTCCAATGTGGGTGCTATGGTTGGTGCAATTGCCAGTGGTCA
GATTGCAGAATACATTGGACGAAAAGGGTCTCTTATGATTGCTGCAATTCCCAATATCATTGGATGGCTTTGCATATCAT
TTGCAAAAGATACTTCTTTTCTTTACATGGGAAGACTTTTAGAAGGCTTTGGCGTTGGGATCATCTCTTACACTGTACCT
GTATATATCGCTGAGATAGCTCCACAAAATATGAGAGGAGGATTGGGTTCGGTTAACCAGCTTTCTGTGACAATTGGAAT
AATGTTGGCGTATTTACTTGGCCTCTTTGTTCCATGGAGAATTCTTGCAGTTCTGGGGATATTGCCGTGTACATTATTGA
TACCAGGTCTCTTTTTCATCCCCGAATCCCCTCGCTGGCTGGCAAAAATGGGTATGACAGATGAATTTGAAACTTCATTA
CAAGTTCTTCGAGGATTTGAGACTGATATTACCGTTGAAGTTAATGAAATCAAGAGATCTGTGGCATCATCTACAAAGCG
AAATACAGTTCGGTTTGTAGATCTCAAACGCAGGAGATACTATTTCCCACTTATGGTTGGTATAGGGTTGCTTGTACTTC
AACAACTTGGTGGAATTAATGGTGTCCTATTCTATTCCAGTACAATATTTGAATCTGCAGGAGTTACATCGAGTAACGCA
GCAACATTTGGGGTCGGGGCTATTCAGGTAGTAGCGACTGCAATATCCACTTGGTTGGTGGACAAAGCAGGTCGTCGGCT
TCTGCTTACTATCTCTTCGGTTGGGATGACGATTAGCCTTGTAATTGTTGCAGCTGCTTTCTATCTTAAGGAATTTGTGT
CTCCTGATTCAGACATGTACAGTTGGCTGAGCATATTGTCAGTAGTTGGAGTTGTGGCAATGGTTGTCTTTTTCTCATTG
GGAATGGGACCAATACCGTGGCTCATTATGTCTGAGATCCTTCCTGTGAACATAAAGGGTTTAGCTGGAAGTATTGCAAC
TCTAGCCAATTGGTTCTTTTCTTGGTTGATCACCATGACAGCAAATTTGCTGTTAGCCTGGAGCAGTGGAGGAACTTTCA
CTCTGTATGGATTGGTTTGTGCATTCACAGTGGTGTTCGTGACTCTATGGGTTCCTGAGACCAAAGGCAAAACTCTTGAA
GAACTTCAATCCTTGTTCAGATGA