Details for Arabidopsis Locus AT1G75210

Position : Chr1 ( 5`- 28223869 .. 28228975 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75210

Protein [Map View]
MSEWFISRNPTFSTAFPSSCITVVNPNFILLSSEFDSYTPQCLFNSLTTTMRLSKRQLSLPLSLCFSTFSPRSRFHHFPG
KYPAPRREFLHTTGTSQLCFKSSMEDQKPSALSENVLQFHTVGSRDGCDVPHEWSSPEGGKKIDISNQIFCNRSLNMKNI
IAVGFDMDYTLAQYKSETFESLAYDGTVRKLVYDLGYPNELLEWTFDWNYMVRGLVLDKKRGNILKMDRHKYVKVAYHGF
RELSKEDKVEIYGSSLVRDSFDEPDYALIDTLFSLAEAYLFAQLVDFKDNNPEKVPKDVDYARMYKDVRAAVDLCHRDGT
LKQMVAKEPNRYINEDTTIVPLIKMIRDSGRSTFLVTNSLWDYTNIVMNFLCGGRTVHGPHTCNFDWLQYFDVVITGSAK
PGFFHEDSRANLFEVEPQSGMLINTDNGTPMAQVGDPSPKILLKSKDKGCRVFQGGNVGHLHSLLSIESSSQVLYVGDHI
YGDILRSKKILGWRTMLVVPELEKEVELLWELRNMRKDLILMRNERDSVEDKIHHLNWSLKFEDINENNKHEMLSALKDL
ESKRDKVRQSHQQAQRECHQKFHKVWGQLMKTGYQSSRFAHQVERFACLYTSQVSNLRLYSPDKYYRPSEDFMSHEFHLL
PL*

DNA
ATGTCTGAGTGGTTTATCAGTAGGAATCCTACTTTTTCGACGGCATTCCCAAGTAGTTGTATTACAGTTGTAAATCCCAA
TTTTATTCTCCTTTCTTCAGAATTCGATTCGTATACTCCTCAATGCCTATTTAATAGTTTAACCACCACCATGCGTCTCT
CTAAACGCCAACTCTCGCTTCCTCTTTCTCTCTGCTTCTCTACTTTCTCTCCTCGTTCCCGTTTCCATCATTTTCCTGGA
AAATATCCAGCTCCTCGAAGAGAATTTCTCCACACTACTGGGACAAGCCAGCTGTGTTTTAAGAGTTCGATGGAAGATCA
GAAACCGAGTGCTCTCAGTGAAAATGTGTTGCAGTTTCACACTGTGGGCTCCAGAGATGGATGTGACGTTCCCCATGAAT
GGTCCTCTCCGGAAGGAGGAAAGAAAATTGATATAAGCAACCAAATTTTCTGCAATAGATCGCTGAATATGAAAAATATT
ATTGCCGTAGGCTTTGATATGGACTACACTCTTGCCCAATACAAGTCCGAAACTTTCGAGTCCCTTGCTTATGACGGAAC
TGTCAGGAAATTGGTATATGATTTGGGATATCCAAATGAGCTGCTAGAGTGGACATTTGATTGGAATTACATGGTTAGAG
GCTTGGTGCTTGACAAAAAGAGGGGAAACATCTTAAAGATGGATCGCCATAAATACGTGAAAGTAGCTTACCATGGGTTT
AGGGAGCTCTCTAAGGAAGATAAAGTTGAAATCTATGGGAGCAGCCTAGTACGAGATTCTTTTGATGAACCCGACTACGC
TCTCATAGATACTCTCTTTTCACTGGCCGAAGCCTATTTGTTCGCTCAACTTGTTGACTTTAAAGATAATAACCCTGAAA
AAGTTCCCAAGGACGTTGATTATGCTCGGATGTATAAAGATGTTCGTGCTGCTGTTGATTTGTGCCACCGTGACGGAACT
TTAAAGCAGATGGTGGCAAAAGAACCTAATAGGTATATCAATGAGGATACCACGATAGTACCCCTTATTAAAATGATCAG
AGATTCTGGACGTTCTACATTCTTAGTAACCAATAGTTTGTGGGACTACACAAATATTGTAATGAACTTTCTCTGCGGAG
GGCGCACAGTACATGGTCCGCATACTTGCAACTTTGATTGGCTCCAGTATTTTGATGTTGTGATCACTGGCAGTGCAAAA
CCTGGGTTCTTCCATGAAGATAGCCGTGCTAACCTTTTTGAGGTGGAACCTCAGTCTGGAATGCTTATTAATACTGACAA
TGGAACACCTATGGCTCAGGTGGGAGATCCTTCACCAAAAATCTTACTGAAGAGTAAAGATAAAGGTTGTCGAGTTTTTC
AAGGTGGAAATGTCGGGCATCTTCACAGTTTGCTCTCAATTGAGTCAAGTTCACAGGTACTTTATGTTGGGGATCATATA
TACGGTGATATCTTGCGCAGCAAAAAAATACTTGGCTGGAGAACTATGCTTGTAGTTCCAGAATTAGAAAAAGAGGTTGA
ACTTTTATGGGAACTGAGGAATATGCGTAAGGATCTTATTTTGATGAGAAATGAGCGTGATTCAGTTGAAGACAAAATTC
ATCACTTGAATTGGTCTCTAAAGTTTGAGGATATCAACGAGAATAATAAGCACGAAATGTTATCAGCGCTCAAGGACTTA
GAGTCTAAAAGAGATAAAGTACGACAGAGTCATCAACAAGCTCAAAGAGAATGTCACCAAAAGTTTCACAAGGTCTGGGG
GCAACTGATGAAAACTGGCTACCAGAGTTCTCGATTTGCTCATCAGGTGGAAAGATTCGCATGCCTGTACACAAGCCAAG
TCTCAAACCTACGCTTGTACTCACCAGACAAGTATTACAGACCCAGTGAAGACTTCATGTCCCATGAATTTCACCTTCTT
CCTCTGTGA