Details for Arabidopsis Locus AT1G75200

Position : Chr1 ( 5`- 28220626 .. 28223709 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75200

Protein [Map View]
MSTTSSVRVRLAFVALLSATTFYCIHKYRRLKHLKNLSLNPSSTLKASRGKIFFISQTGTAKALAQRLHELCASNDIAFD
IVDPHSYEPEDLPKETLVLFIASTWDGGKPPKNGEFLVNWLGESAEDFRVGSLLLSDCKFAVFGVGSRAYGESYNAVAKE
LSSRMIGLGGLEMIPVGEGDVDDGELDRAFQDWCDGVIRVLKGGSAQETNGVSQQIGAVEDDLEYYDSTDEEDEDNDADG
GIVDLEDIAGKAPSKRNGVVKVTKVDGKKEMVTPVIRASLTKQGYKIIGSHSGVKICRWTKSQLRGRGGCYKHSFYGIES
HRCMETTPSLACANKCVFCWRHHTNPVGKSWQWKMDEPSVIVKGALDLHKNMIKQMKGVPGVTPEKLQEGLNPRHCALSL
VGEPIMYPEINALVDELHGRRISTFLVTNAQFPEKILMMKPITQLYVSVDAATKESLKAIDRPLFADFWERFIDSLKALQ
EKQQRTVYRLTLVKGWNTEELDAYFNLFSIGKPDFIEIKGVTYCGSSATSKLTMENVPWHTDVKAFSEALSLKSNGEYEV
ACEHAHSCCVLLGRTEKFKVDGKWFTWIDYEKFHDLVASGEPFTSTDYMAQTPSWAVYGAQEGGFDPGQLRYKKERNHPP
KPQAVLA*

DNA
ATGTCTACGACTTCCTCCGTGCGTGTTCGACTAGCTTTCGTTGCGTTACTCTCAGCGACGACTTTTTACTGTATCCATAA
ATATCGTCGCTTGAAACATCTGAAAAACCTCTCGTTAAACCCTAGCTCTACATTGAAAGCCAGCAGAGGAAAGATCTTCT
TCATCTCCCAAACTGGTACAGCTAAAGCCTTAGCTCAACGGCTTCACGAGCTATGCGCATCTAACGACATAGCATTTGAT
ATCGTCGATCCACATAGCTACGAACCTGAAGATCTACCTAAAGAAACCCTAGTTTTATTCATCGCGTCGACTTGGGATGG
CGGGAAGCCGCCTAAGAACGGAGAGTTTCTTGTGAACTGGCTTGGTGAGAGCGCTGAAGATTTCCGAGTCGGCTCGCTTC
TTCTCTCCGATTGCAAATTCGCTGTTTTCGGTGTCGGGAGCCGTGCGTATGGTGAATCGTATAATGCTGTGGCGAAGGAA
TTGTCGAGTAGGATGATAGGACTGGGTGGACTCGAGATGATTCCGGTGGGAGAAGGCGATGTTGATGATGGAGAATTAGA
TAGAGCATTTCAAGACTGGTGTGATGGAGTTATTAGGGTTCTGAAAGGAGGATCTGCTCAAGAAACAAATGGGGTTTCGC
AGCAGATTGGTGCTGTTGAGGATGATCTGGAGTACTACGATTCAACAGATGAGGAAGATGAAGACAATGATGCAGACGGA
GGTATTGTTGATCTTGAAGATATTGCTGGAAAAGCTCCTTCAAAGAGAAATGGTGTAGTTAAAGTGACTAAAGTTGATGG
AAAGAAGGAAATGGTGACCCCTGTGATTAGAGCAAGCTTAACGAAGCAGGGCTATAAAATTATCGGGTCGCATAGTGGGG
TTAAGATATGTAGATGGACAAAGTCACAACTTAGAGGCAGGGGAGGTTGCTACAAGCACTCCTTTTATGGCATTGAGAGT
CACAGGTGCATGGAGACAACACCTAGTTTGGCTTGTGCAAACAAATGTGTGTTTTGTTGGAGGCATCACACAAATCCTGT
GGGAAAGAGCTGGCAGTGGAAGATGGATGAGCCTTCAGTGATTGTGAAAGGCGCTCTTGATCTTCATAAAAATATGATTA
AGCAAATGAAAGGAGTTCCAGGTGTAACTCCAGAGAAATTACAAGAAGGTCTTAACCCAAGACATTGTGCGTTATCACTT
GTTGGTGAGCCGATTATGTATCCGGAGATCAATGCCCTTGTAGATGAGCTACATGGAAGGCGTATTTCTACGTTTTTGGT
TACAAATGCACAATTCCCCGAAAAGATTTTGATGATGAAGCCTATCACCCAGTTGTACGTAAGTGTAGATGCTGCCACCA
AAGAGAGCTTGAAGGCCATTGATAGACCTCTCTTTGCTGACTTTTGGGAACGGTTCATTGACTCCTTGAAAGCTCTCCAA
GAGAAGCAGCAGCGAACCGTCTACCGTTTAACACTTGTCAAAGGATGGAACACAGAGGAGCTAGATGCTTATTTCAACCT
ATTCAGCATTGGGAAACCTGATTTTATCGAGATCAAAGGCGTCACATACTGCGGATCCTCTGCAACGTCAAAGTTGACAA
TGGAGAATGTACCGTGGCACACAGATGTTAAAGCATTCTCAGAAGCTCTGTCTCTGAAGAGCAATGGGGAGTACGAGGTT
GCTTGCGAGCACGCCCACTCTTGCTGTGTTCTTCTAGGGAGAACGGAAAAGTTCAAAGTGGATGGAAAGTGGTTCACTTG
GATTGACTATGAAAAGTTCCACGATCTGGTTGCTTCTGGAGAACCGTTCACGAGCACAGACTATATGGCTCAAACACCAT
CGTGGGCGGTTTATGGAGCGCAGGAAGGTGGGTTTGATCCAGGGCAGTTGCGTTACAAGAAGGAAAGGAATCATCCTCCT
AAACCACAGGCGGTTTTAGCTTAA