Details for Arabidopsis Locus AT1G75100

Position : Chr1 ( 5`- 28190816 .. 28193800 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75100

Protein [Map View]
MQTLPSSETVLLGSNSAPPVLRSPGGDDVDIDFGDVFGGPPKRRSKVTSNEVTRHSFSESALRRRDVIVDVGDLLPQDEK
PVFGEDTSSVRRRFTTDDFFDDIFRVNESSSLPGSRILSPAHKPESSSGTSSPSQFSLPAKATEIPTFNLAATRSLNKNK
ETVSSSPLSRTSSKADVVSTAKSYSDDCDDPPQVFVTGKGRQFHFSIYKWPNKGVPVVIWGSSRLSSMSKAEETTPVPLS
DYRKTSVVEKLGKNEEGDGKSGLSGLKDVKKTSLKRPGVQTKEEKTETDLKSEQAFFGVSKAREANVKPLDSVESEQAFS
GVSKAHEATTVKPLHSIFHEEDERQDEKIVSEREVRKGKSKAKNTRSFTEDSRTKKKSQGTKSSLDSSPIPDKSSFASSS
AAPEVGKDGVKGKVSDFVKIFSKGASVGAGGESLGQSSRWRAKETPKTDIIHDGSNAKETVNIPDQQKKSTPDIPAMNRD
QKPSQSTQKKDSDRESMNYKAPGDTVQEERQEPSTTHTTSEDIDEPFHVNFDVEDITQDENKMEEANKDAEEIKNIDAKI
RKWSSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQRALLILHPDKLQQKGASANQKYMAEKVFELLQE
AWDHFNTLGPV*

DNA
ATGCAGACATTACCAAGCTCAGAAACCGTTCTTTTAGGCTCCAACTCAGCACCACCTGTGTTGCGTAGTCCCGGTGGCGA
TGACGTGGACATCGATTTTGGTGACGTGTTTGGTGGTCCTCCTAAGAGACGCTCTAAAGTTACTAGTAACGAAGTCACAC
GACATAGCTTCAGTGAATCCGCTCTCCGGCGTCGTGACGTCATCGTCGACGTCGGCGATCTGCTTCCGCAAGACGAGAAG
CCTGTATTCGGCGAAGATACATCATCTGTCCGGCGTCGTTTCACCACTGATGATTTCTTCGACGATATTTTCAGAGTTAA
TGAATCATCATCACTTCCGGGTTCTCGGATCCTTAGCCCGGCTCACAAACCCGAATCTTCTTCAGGGACTTCGTCTCCAT
CCCAATTCAGTCTTCCTGCAAAAGCAACAGAGATTCCAACATTTAATTTAGCAGCTACTCGTAGTTTGAACAAGAACAAA
GAAACTGTTTCGAGCTCTCCTTTGTCAAGAACTTCAAGCAAAGCAGATGTGGTCTCTACTGCTAAATCATATTCAGATGA
TTGTGATGATCCTCCACAAGTTTTTGTTACTGGGAAAGGAAGGCAATTTCATTTCTCTATCTACAAGTGGCCTAATAAAG
GAGTTCCTGTTGTTATTTGGGGAAGCTCTAGATTGAGTTCTATGTCTAAAGCTGAGGAGACAACACCTGTACCATTGAGT
GATTATCGAAAAACTTCAGTTGTTGAGAAATTGGGTAAAAATGAAGAAGGAGATGGAAAAAGTGGTTTATCTGGTTTGAA
AGATGTGAAGAAGACCTCGCTAAAGCGTCCTGGTGTCCAGACAAAAGAAGAGAAAACAGAAACAGATTTGAAGTCTGAAC
AAGCCTTCTTTGGTGTCTCAAAAGCACGTGAGGCTAATGTGAAGCCTCTTGATTCAGTTGAGTCTGAACAGGCCTTCTCT
GGTGTGTCAAAAGCACATGAAGCTACTACTGTGAAGCCTCTTCATTCAATTTTTCATGAAGAAGATGAGAGACAAGATGA
GAAAATAGTATCAGAGAGAGAAGTGAGAAAAGGTAAAAGCAAAGCGAAGAACACTCGAAGTTTTACCGAAGATTCAAGAA
CCAAGAAGAAATCACAAGGCACTAAAAGTTCTTTGGATAGTAGCCCGATACCCGATAAATCCAGCTTCGCAAGTTCATCA
GCAGCACCAGAAGTTGGCAAAGATGGAGTCAAAGGAAAAGTGAGTGACTTCGTTAAGATTTTCAGTAAAGGAGCTTCAGT
TGGAGCAGGTGGGGAATCTCTTGGACAAAGCTCTAGATGGAGAGCTAAAGAAACTCCCAAGACTGATATCATTCATGATG
GTTCTAATGCCAAGGAAACTGTAAACATTCCTGATCAACAAAAGAAATCGACTCCAGATATCCCCGCTATGAATCGGGAT
CAGAAACCTTCACAGTCAACTCAGAAAAAAGATTCAGACCGGGAGAGCATGAACTATAAGGCTCCTGGTGATACTGTACA
AGAAGAGAGACAAGAACCTAGCACAACACATACTACCTCAGAGGATATAGATGAGCCCTTCCATGTAAATTTCGATGTGG
AGGATATAACACAAGATGAAAACAAAATGGAAGAGGCCAATAAGGATGCTGAAGAAATCAAGAACATCGATGCTAAAATC
CGCAAGTGGTCAAGCGGAAAGAGTGGAAACATTCGGTCTCTTCTATCCACGCTGCAATATATTCTTTGGTCTGGGAGCGG
GTGGAAGCCGGTTCCTCTAATGGATATGATCGAAGGAAACGCGGTTCGAAAATCGTACCAGAGGGCATTACTAATACTTC
ATCCAGACAAACTACAACAAAAGGGTGCTTCTGCAAACCAGAAATACATGGCCGAGAAAGTTTTCGAATTATTACAGGAA
GCATGGGACCACTTCAACACTCTCGGACCGGTTTAA