Details for Arabidopsis Locus AT1G75090

Position : Chr1 ( 5`- 28187447 .. 28189725 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75090

Protein [Map View]
MSIVSKLRSPVKPIDESRAILCSTGNRFKVTKTEMTKKPQLNPRVTKSPATKKPDSNFSVSTDDSSSSSSSSERSSVNTT
NSGKVTTPSKRNGVEKLNNVVASVAVVEDISPKIPGPVKRCHWITPNSDPIYVLFHDEEWGVPVRDDKKLFELLVFSQAL
AEFSWPSILRRRDDFRKLFEEFDPSAIAQFTEKRLMSLRVNGCLILSEQKLRAIVENAKSVLKVKQEFGSFSNYCWRFVN
HKPLRNGYRYGRQVPVKSPKAEYISKDMMQRGFRCVGPTVMYSFLQASGIVNDHLTACFRYQECNVETERETKSHETETK
LDLHSPLLV*

DNA
ATGTCTATAGTCTCTAAGCTTCGTTCTCCGGTTAAACCAATAGATGAGTCACGAGCTATCCTCTGTTCGACCGGGAACAG
ATTTAAGGTTACGAAAACAGAAATGACGAAGAAGCCACAACTGAATCCACGAGTGACGAAATCTCCGGCGACGAAGAAGC
CCGATTCCAATTTCTCAGTTTCGACTGATGATTCCTCTTCTTCTTCTTCATCCTCGGAACGTTCGTCAGTGAACACGACA
AACTCTGGGAAAGTAACCACTCCGTCGAAACGGAACGGAGTTGAGAAGCTCAATAATGTCGTTGCCTCCGTCGCCGTCGT
TGAAGACATTAGTCCTAAAATTCCGGGACCGGTCAAGAGATGCCACTGGATCACACCTAATTCAGACCCGATCTATGTTT
TGTTCCACGACGAGGAATGGGGTGTTCCAGTTCGTGATGACAAGAAACTCTTCGAGCTACTTGTCTTCTCACAAGCTTTG
GCTGAGTTTAGCTGGCCTTCAATCCTACGCAGAAGAGACGACTTTAGGAAGCTCTTTGAAGAGTTTGATCCTTCAGCTAT
AGCACAATTCACAGAGAAGAGGTTGATGTCTCTTAGAGTTAATGGGTGTCTAATTCTATCCGAACAGAAACTGCGAGCAA
TTGTAGAGAACGCGAAATCTGTTCTCAAGGTCAAGCAGGAATTTGGATCGTTCAGTAATTATTGTTGGAGATTTGTGAAC
CACAAGCCATTAAGAAATGGCTATCGATATGGTCGTCAAGTACCGGTTAAGTCCCCAAAGGCAGAGTACATTAGCAAAGA
TATGATGCAGAGAGGGTTTCGCTGCGTTGGTCCTACTGTTATGTATTCCTTCTTGCAGGCCTCTGGCATTGTTAATGATC
ATCTCACAGCTTGTTTCAGATACCAAGAATGTAATGTTGAGACTGAGAGAGAAACAAAAAGCCATGAGACTGAAACCAAA
CTGGATCTGCATTCTCCATTACTTGTTTGA