Details for Arabidopsis Locus AT1G75080

Position : Chr1 ( 5`- 28185504 .. 28188075 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75080

Protein [Map View]
MTSDGATSTSAAAAAAAAAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKALCVEAGWVV
EEDGTTYRKGCKPLPGEIAGTSSRVTPYSSQNQSPLSSAFQSPIPSYQVSPSSSSFPSPSRGEPNNNMSSTFFPFLRNGG
IPSSLPSLRISNSCPVTPPVSSPTSKNPKPLPNWESIAKQSMAIAKQSMASFNYPFYAVSAPASPTHRHQFHTPATIPEC
DESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQMSPNTAAFQEIGQSSEFKFENSQVKPWEGERIHDV
GMEDLELTLGNGKARG*

DNA
ATGACTTCGGATGGAGCTACGTCGACATCAGCAGCTGCAGCTGCGGCGGCGGCAGCAGCGGCGAGGAGGAAGCCGTCGTG
GAGAGAAAGGGAGAATAATCGGAGGAGAGAAAGACGGAGAAGAGCTGTAGCTGCGAAGATATACACTGGGCTTAGAGCTC
AAGGTGATTATAATTTGCCTAAACATTGTGATAATAATGAAGTCCTTAAAGCTCTTTGTGTTGAAGCTGGTTGGGTTGTT
GAAGAAGATGGTACTACTTATCGCAAGGGATGCAAGCCTTTACCTGGTGAGATAGCTGGGACTTCATCTCGAGTAACTCC
ATATTCATCACAGAACCAGAGCCCTCTTTCATCAGCCTTTCAAAGTCCCATCCCATCTTACCAAGTTAGCCCGTCTTCTT
CATCATTCCCGAGTCCTTCTCGCGGTGAACCAAATAACAACATGTCCTCTACATTCTTCCCTTTCCTCAGAAATGGTGGC
ATTCCTTCTTCTCTTCCTTCCCTCAGAATCTCAAACAGTTGTCCAGTTACCCCACCGGTCTCATCGCCGACTTCTAAGAA
CCCGAAACCGTTGCCTAACTGGGAATCTATCGCTAAGCAATCCATGGCCATTGCTAAACAATCAATGGCGTCTTTTAATT
ATCCTTTCTATGCGGTTTCTGCACCTGCTAGTCCGACACATCGCCACCAGTTTCATACCCCGGCTACTATACCTGAATGT
GATGAGTCTGACTCTTCCACTGTTGATTCTGGTCATTGGATAAGCTTTCAGAAGTTTGCACAACAACAGCCATTCTCTGC
CTCTATGGTGCCAACCTCTCCTACCTTCAATCTTGTGAAACCTGCGCCTCAGCAGATGTCTCCAAATACTGCTGCCTTCC
AAGAGATTGGTCAAAGCTCTGAGTTTAAATTTGAGAATAGCCAAGTTAAACCCTGGGAAGGAGAGAGGATACATGATGTG
GGTATGGAGGATCTTGAGCTTACACTTGGAAATGGGAAGGCTCGTGGTTGA