Details for Arabidopsis Locus AT1G75060

Position : Chr1 ( 5`- 28181275 .. 28183503 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75060

Protein [Map View]
MLEAPVNKSSILNGGGGGFSQLQSCFGDCSSEEELSVLPRHTKVVVTGNNRTKSVLVGLQGVVKKAVGLGGWHWLVLTNG
IEVKLQRNALSVLEHPTGNEEDNDLEVDHSTQWNHPSDMTTEDTLKPHKSKKRGHRSSRLSQKALYREVSCDSHSKISSI
TPRLNMKVDLTKLDMAALLRYWRHFNLVDALPNPTKEQLIDIIQRHFMSQQMDELQVIVGFVQAATGMKKACQVEDQRSQ
KH*

DNA
ATGCTGGAAGCTCCGGTGAACAAGTCAAGCATCCTCAATGGAGGAGGAGGAGGATTCTCTCAGCTACAGAGTTGCTTCGG
CGATTGCAGTAGCGAAGAAGAATTGTCAGTGTTGCCACGTCATACCAAAGTTGTCGTTACTGGAAACAACCGTACCAAAT
CTGTTCTCGTCGGTCTTCAAGGCGTCGTTAAGAAAGCCGTCGGACTCGGTGGTTGGCATTGGCTGGTTTTGACTAATGGA
ATTGAAGTGAAGTTGCAGAGGAATGCGCTTAGTGTTCTTGAACATCCTACAGGGAACGAAGAAGACAATGATCTTGAAGT
CGACCATTCTACACAGTGGAATCATCCCTCCGATATGACAACTGAGGACACTTTGAAGCCTCATAAGTCGAAGAAGAGAG
GACACAGATCATCGCGGTTATCTCAAAAGGCTTTGTACAGGGAAGTTTCTTGTGACTCACACTCAAAAATCTCGAGTATT
ACTCCTCGTCTGAACATGAAGGTTGATCTTACCAAGTTGGATATGGCTGCATTACTGAGATATTGGCGACATTTTAACCT
CGTGGATGCTCTTCCGAATCCCACAAAGGAGCAACTAATTGACATTATTCAGAGACACTTCATGTCTCAGCAAATGGATG
AGCTTCAGGTTATTGTGGGATTCGTTCAGGCTGCAACAGGAATGAAGAAGGCTTGCCAAGTGGAAGACCAAAGAAGCCAG
AAACACTGA