Details for Arabidopsis Locus AT1G75030

Position : Chr1 ( 5`- 28174378 .. 28175383 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75030

Protein [Map View]
MAKISSIHILFFVFITSGIADSATVFTLQNSCAYTVWPGTLSGNSITLGDGGFPLTPGASVQLTAPTGWSGRFWARTGCN
FDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGIKPQGGFGNCKYAGCVSDINEI
CPSELRIMDPNSGSVAACKSACAAFSSPEFCCTGAHATPQTCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLIT
FCPTQS*

DNA
ATGGCGAAAATCTCCAGTATTCACATTCTCTTCTTCGTCTTCATCACAAGTGGCATTGCTGATTCCGCCACCGTATTCAC
TTTACAAAACAGTTGTGCGTACACCGTTTGGCCGGGAACTCTCTCCGGCAACAGCATCACCCTCGGCGACGGCGGATTTC
CCTTAACTCCAGGCGCTTCCGTGCAGCTCACGGCTCCTACCGGTTGGTCAGGCCGGTTCTGGGCTCGTACCGGCTGCAAC
TTTGACGCCTCCGGTCACGGTACCTGCGTCACCGGAGACTGCGGCGGCGTTTTAAAATGTACCGGCGGCGGAGTTCCTCC
AGCGACTCTAGCGGAATTCACCGTGGGATCAAGCAATGCCGGCATGGATTTCTACGACGTGAGCCTCGTCGACGGTTACA
ATGTAAAGATGGGGATAAAACCACAGGGAGGATTCGGAAATTGCAAATACGCAGGCTGCGTCTCGGACATCAACGAGATT
TGCCCTAGCGAGCTTAGGATCATGGATCCGAATTCGGGAAGTGTCGCGGCGTGTAAGAGCGCTTGCGCGGCGTTTAGTTC
GCCGGAATTTTGCTGTACTGGTGCTCACGCGACGCCGCAAACTTGTTCTCCGACGTATTACTCGTCCATGTTTAAGAACG
CTTGTCCTAGCGCTTATAGTTACGCTTACGACGACGCATCGAGCACTTTCACTTGTACCGGATCTAACTACTTGATCACT
TTCTGCCCTACCCAGTCTTAA