Details for Arabidopsis Locus AT1G75020

Position : Chr1 ( 5`- 28171018 .. 28173436 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75020

Protein [Map View]
MEVCGDLKSDNLKNRPLTPLRILRGLMILLVFLSTAFMFLLYFAPIAALGLRLLSVQQSRKVVSLIFGLWLALWPYLFET
VNGTTVVFSGDIIPVEKRVLLIANHRTEVDWMYLWNIALRKGCLGYIKYVLKSSLMKLPIFGWGFHVLEFIPVERKREVD
EPVLLQMLSSFKDPQEPLWLALFPEGTDFTEEKCKRSQKFAAEVGLPALSNVLLPKTRGFGVCLEVLHNSLDAVYDLTIA
YKPRCPSFMDNVFGTDPSEVHIHVRRVLLKEIPANEAESSAWLMDSFKLKDKLLSDFNAQGKFPNQRPEEELSVLKCIAT
FAGVISLTVVFIYLTLYSHSCFKVYACLSGTYLTFATYYKFQPSPGCFREDSCKVKNH*

DNA
ATGGAAGTTTGCGGGGATCTGAAATCTGATAACTTAAAGAACCGCCCCTTGACTCCGCTTAGGATTCTGAGGGGCTTGAT
GATCCTGCTGGTGTTTCTGTCTACTGCTTTTATGTTTCTGCTGTACTTTGCACCAATAGCTGCTCTAGGTCTACGGCTTC
TGAGTGTGCAACAATCTAGAAAAGTTGTTTCGTTAATCTTTGGTCTCTGGTTAGCTTTGTGGCCTTACCTGTTTGAAACG
GTTAACGGGACAACTGTGGTGTTCTCTGGAGACATCATTCCGGTTGAGAAACGTGTTTTGCTTATTGCAAATCACAGGAC
GGAGGTGGATTGGATGTATCTGTGGAATATTGCCTTGAGAAAAGGCTGTCTTGGCTACATCAAATACGTGCTCAAGAGCA
GCTTGATGAAATTACCTATTTTTGGTTGGGGCTTTCATGTTTTGGAATTTATCCCGGTGGAGAGGAAGCGGGAGGTCGAC
GAACCTGTTTTGCTTCAAATGCTTTCATCTTTTAAGGATCCTCAAGAACCCTTATGGCTTGCTCTATTCCCTGAAGGAAC
CGATTTCACTGAAGAGAAATGCAAGAGAAGCCAAAAGTTTGCAGCTGAAGTTGGTCTTCCAGCACTATCAAACGTACTTC
TACCAAAAACAAGGGGTTTTGGCGTTTGCTTAGAAGTTCTTCATAACTCTTTGGATGCAGTATATGATTTGACTATCGCA
TATAAACCTCGCTGCCCATCTTTCATGGACAATGTATTCGGGACGGATCCTTCAGAAGTACATATCCACGTTCGGCGAGT
TCTACTAAAGGAGATTCCAGCAAACGAGGCAGAATCTTCTGCTTGGTTAATGGATTCATTTAAGTTGAAGGACAAACTGC
TATCCGATTTCAATGCTCAGGGGAAATTCCCCAATCAAAGACCAGAAGAAGAACTCTCTGTTCTCAAGTGCATTGCAACA
TTTGCAGGGGTAATATCTTTGACAGTAGTGTTCATATATCTGACCTTGTATTCACATAGCTGTTTCAAAGTATATGCTTG
TCTAAGCGGCACATATTTAACTTTTGCTACATATTACAAGTTCCAACCCTCACCTGGCTGTTTTAGAGAAGATTCTTGTA
AAGTTAAAAACCATTAA