Details for Arabidopsis Locus AT1G75010

Position : Chr1 ( 5`- 28164840 .. 28170054 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75010

Protein [Map View]
MPISMELPVFSTLRVPLFSRLALLPTFGVPFSSLGATTRLNCTSRKARRICVMCLVRDSAPIETCERAGEDGSDEFIEVL
VIGSRKESIMDSCLDSPFPSLPLRFWSISKDSSGGLVLQQRLNHQDNALKTMNPIELLQSRPRAFILVASAGYGSDQVEA
INILSAVRSGGNLAVAVLLKPFSFEGRKRLEEVNELARKLQQHTNFCIDIDIEVLLQKDLVTLDEALRNANNAVSMAINA
ASALISGMHGNFIDVMHKDLKELEGSEVKTILESYKEAKVGFGVGHNLKTSILRAIYDCPFFRPGLKDLNAIICIVASSV
PLQKKDVKTILRTFRQTMEYTGDIIVSTVHEPDLEPKVRVTTFFILSSSEVETSNKGNIFSGLVPFVLNIFTRYRSQLQK
ETNIGLGETPVSIKDSADSTDVKTSNQNIEEFEIDSEDLLEVSENGDDSEYPLKEGEPSRNSRLDLKDENVEDFGAIQRE
PIANWSMDQGYQIEQKWQADSGDTAVLSLGIVNLPVGVRPSKKLNSNLSVASQLSRKADSREESFFNPNGSTKDSSDTAS
TLLSEKYADFTKQRNLSARASSMLEAERDSSKRWSPILEMQYRGGLFKGRCQGGLPEGKGRLVLGDGSIYDGMWHNGKRS
GLGTFYFKNGDVFQGTWREDLIHGKGWFYFHKGDRWFANFWKGKASGEGRFYSKSGEIFFGHFKDGWRHGQFLCIDLDGT
RYSETWDDGVLIDRKQVDAGD*

DNA
ATGCCGATTTCTATGGAACTTCCAGTTTTCTCTACTCTCCGAGTACCATTGTTCTCTCGTTTAGCTTTACTTCCTACTTT
TGGAGTTCCGTTTTCGTCCCTTGGTGCTACGACGCGATTGAACTGTACATCTCGAAAGGCGCGTCGGATTTGCGTGATGT
GCTTAGTGAGGGATTCTGCTCCGATAGAGACGTGCGAGAGAGCTGGAGAAGATGGGTCTGACGAGTTCATTGAGGTTCTT
GTCATCGGTAGTCGCAAGGAGTCTATCATGGATTCATGCTTGGATTCTCCTTTTCCTTCTCTTCCTCTGCGATTTTGGAG
TATTAGCAAGGACAGCTCTGGAGGTTTAGTGTTACAGCAGAGGCTCAATCACCAAGATAATGCCTTGAAGACCATGAATC
CAATTGAGCTGTTACAGTCACGTCCAAGGGCCTTCATCCTTGTGGCTAGTGCTGGATATGGTTCTGACCAGGTTGAAGCT
ATTAATATTCTTAGTGCAGTAAGATCTGGGGGTAACTTAGCTGTTGCTGTGCTATTAAAGCCTTTCAGCTTTGAAGGCCG
AAAGCGTCTAGAAGAGGTTAACGAGTTGGCTAGAAAACTGCAGCAACACACCAATTTCTGTATAGATATCGACATAGAGG
TTTTACTACAGAAGGATTTGGTAACTTTGGACGAGGCGCTGAGAAATGCAAACAATGCTGTGTCTATGGCAATAAATGCA
GCTTCCGCTCTGATAAGTGGGATGCATGGAAACTTCATCGATGTGATGCATAAAGATCTTAAAGAACTTGAAGGTTCAGA
AGTTAAAACGATTCTAGAAAGTTACAAAGAGGCAAAGGTTGGTTTTGGAGTTGGTCACAACCTTAAGACTTCGATATTAC
GAGCTATATATGACTGCCCATTCTTTCGACCTGGTCTAAAGGATCTAAACGCTATTATATGCATTGTGGCTAGTTCGGTA
CCTCTCCAGAAGAAAGACGTGAAAACAATTCTTCGTACTTTCCGTCAAACTATGGAGTACACTGGAGATATTATAGTATC
TACTGTTCATGAGCCTGATCTGGAGCCTAAAGTGCGTGTCACAACGTTTTTTATTCTAAGTTCTTCAGAAGTGGAAACAT
CCAACAAAGGCAACATTTTTTCTGGTCTTGTTCCTTTTGTTTTAAATATCTTCACGAGATATCGTTCACAGCTCCAAAAA
GAAACAAATATTGGACTTGGAGAGACGCCAGTTTCAATTAAAGATTCAGCAGACTCTACTGACGTAAAAACTTCCAATCA
GAATATTGAGGAATTTGAAATTGACTCTGAGGACCTCCTGGAAGTTTCTGAGAACGGTGATGATAGTGAATACCCATTAA
AAGAGGGGGAACCATCCAGAAACAGTCGTCTGGATCTTAAAGATGAAAATGTAGAAGATTTTGGTGCTATCCAGAGGGAG
CCTATTGCCAATTGGAGTATGGATCAGGGATATCAGATTGAGCAGAAATGGCAAGCTGATTCTGGAGACACTGCAGTGCT
TAGCCTGGGAATTGTCAACCTTCCTGTTGGTGTGAGACCTTCGAAGAAATTGAACAGTAATCTCAGTGTTGCCAGTCAAC
TCTCTAGGAAGGCTGATTCCAGAGAAGAATCATTTTTCAACCCTAATGGCTCGACAAAAGACTCTAGTGATACTGCATCT
ACCCTGCTATCTGAGAAATATGCTGATTTTACAAAGCAAAGAAATCTATCCGCTCGAGCATCGTCTATGCTGGAAGCTGA
ACGAGATTCATCAAAAAGATGGAGTCCTATTCTTGAGATGCAGTACAGAGGAGGACTTTTCAAGGGAAGATGCCAAGGAG
GCCTTCCCGAAGGAAAGGGTCGTTTGGTACTTGGAGATGGAAGCATATATGATGGAATGTGGCACAACGGTAAAAGATCT
GGTCTCGGAACATTCTACTTCAAGAATGGAGACGTGTTCCAAGGCACATGGAGAGAAGATTTAATACACGGAAAGGGTTG
GTTTTATTTCCACAAAGGTGATCGATGGTTTGCAAATTTCTGGAAAGGAAAAGCCAGTGGCGAAGGCCGGTTCTATTCAA
AGTCCGGTGAGATATTCTTTGGACATTTCAAAGATGGTTGGCGCCACGGACAATTCCTCTGTATAGATTTGGATGGAACA
AGATACTCTGAAACTTGGGACGACGGTGTTCTCATTGACCGGAAACAAGTGGACGCCGGAGATTGA