Details for Arabidopsis Locus AT1G75000

Position : Chr1 ( 5`- 28163650 .. 28164586 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G75000

Protein [Map View]
MTTFNYYLAEHPTIVNFRWSPTQSYASTWSFLFTAVSSYIIAAVTLHLLLLITLSLSNRRRGFSLGPIPALHSLTISIIS
AVIFVGILLSAAAEIRDTRWLWRRTRTTALQWFLCFPVGTRASGRVFFWSYAFYLSRFLHLFRTFFSVIRRRKLSFFQLI
NQSSLLCISFLWLEYSQSFQVVAILLTTVSYAVVYGYRFWTEIGLRGACFPFVGNCQAILLGCMTVCHVGVLCIHLVKRG
GCNGIGAWLFNSVLNAVITLLYLKFYCKTRSMMTKANHNTT*

DNA
ATGACGACGTTCAATTACTATTTAGCGGAGCATCCAACGATCGTTAACTTCCGTTGGAGTCCAACCCAATCCTACGCCTC
CACGTGGTCTTTCCTCTTCACCGCCGTCTCATCTTACATCATCGCCGCCGTCACTCTCCACCTCCTCCTCCTCATAACCC
TCTCCCTCTCTAACCGCCGCCGCGGATTCTCCCTCGGTCCAATCCCAGCTCTACACAGCTTAACCATTTCCATAATCTCC
GCCGTCATATTCGTCGGTATCCTCCTCTCCGCCGCAGCAGAGATCAGAGACACGCGGTGGCTATGGCGTCGCACCCGCAC
CACTGCTCTCCAATGGTTCCTCTGCTTTCCCGTAGGTACACGCGCTTCGGGACGCGTGTTCTTCTGGTCATACGCGTTTT
ACCTCTCAAGATTCCTTCACTTGTTCCGTACTTTCTTCTCCGTGATACGACGTCGTAAACTCAGCTTCTTCCAGCTTATC
AACCAGTCTTCTCTTCTCTGTATCTCCTTCCTCTGGCTCGAATATTCCCAATCCTTTCAGGTGGTAGCGATACTATTAAC
GACCGTTTCGTACGCCGTTGTGTACGGTTACAGGTTCTGGACGGAGATTGGGTTGCGTGGCGCGTGTTTTCCGTTTGTCG
GAAACTGTCAAGCCATTCTGTTAGGGTGTATGACGGTTTGCCACGTAGGCGTACTCTGTATACACCTGGTCAAACGCGGC
GGTTGTAACGGTATCGGTGCTTGGTTGTTTAACTCTGTTCTTAACGCCGTTATCACGTTGCTCTACTTGAAGTTTTATTG
CAAGACGCGTTCAATGATGACCAAGGCTAATCACAACACCACATAA