Details for Arabidopsis Locus AT1G74970

Position : Chr1 ( 5`- 28157530 .. 28159302 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74970

Protein [Map View]
MASITNLASSLSSLSFSSQVSQRPNTISFPRANSVFALPAKSARRASLSITATVSAPPEEEEIVELKKYVKSRLPGGFAA
QKIIGTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYENSYDIFVKAHGGGLSGQAQAITLG
VARALLKVSADHRSPLKKEGLLTRDARVVERKKAGLKKARKAPQFSKR*

DNA
ATGGCGTCGATTACGAACCTCGCCTCTTCTCTCTCTTCACTCTCGTTCTCCTCCCAAGTTTCTCAAAGACCTAACACCAT
TTCCTTCCCCCGCGCGAATTCAGTATTCGCATTACCGGCGAAATCCGCACGCCGCGCTTCTCTATCTATCACCGCCACGG
TATCTGCTCCACCGGAGGAGGAGGAGATAGTTGAACTGAAGAAATACGTCAAATCGAGGCTTCCCGGAGGATTTGCTGCT
CAGAAGATTATTGGCACTGGACGACGTAAGTGCGCAATCGCTAGAGTTGTTCTTCAGGAAGGTACTGGGAAGGTTATCAT
CAACTATCGTGATGCCAAGGAGTACCTTCAGGGAAATCCATTGTGGCTTCAGTATGTTAAAGTACCATTGGTGACTTTAG
GATATGAGAATAGCTACGACATATTTGTGAAAGCCCATGGAGGCGGTCTCTCAGGTCAAGCTCAAGCAATTACCTTGGGA
GTCGCACGTGCACTCCTGAAGGTAAGTGCAGACCACAGATCGCCTTTGAAGAAGGAAGGTTTGCTCACTAGAGATGCGAG
AGTGGTTGAAAGAAAGAAGGCCGGGCTCAAGAAGGCGCGTAAAGCCCCACAATTCTCCAAGCGTTAA