Details for Arabidopsis Locus AT1G74960

Position : Chr1 ( 5`- 28151924 .. 28156259 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74960

Protein [Map View]
MVGASSSYASPLCTWFVAACMSVSHGGGDSRQAVALQSGGRSRRRRQLSKCSVASGSASIQALVTSCLDFGPCTHYNNNN
ALSSLFGSNSVSLNRNQRRLNRAASSGGAMAVMEMEKEAAVNKKPPTEQRRVVVTGMGVETSLGHDPHTFYENLLQGNSG
ISQIENFDCSEFPTRIAGEIKSFSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGGVTDEVMAEFDKTKCGVLIGSAMGG
MKVFYDAIEALRISYKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILNSANHIIKGEADVMLCGGSD
AVIIPIGLGGFVACRALSQRNNDPTKASRPWDTNRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTE
PHPDGAGVILCIERALASAGISKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSMIGHLLGAAGAVEAVA
TVQAIRTGWVHPNINLENPDSGVDTKLLVGPKKERLDIKAALSNSFGFGGHNSSIIFAPYK*

DNA
ATGGTGGGTGCGTCTTCCTCTTACGCATCTCCGTTATGTACCTGGTTTGTTGCTGCTTGCATGTCCGTCTCTCACGGTGG
AGGAGATAGCCGTCAGGCTGTTGCTCTTCAATCTGGTGGGCGGAGTCGGCGAAGGAGGCAGCTTAGCAAATGCTCTGTCG
CTTCTGGATCCGCTAGCATTCAGGCTCTCGTCACTTCTTGTTTGGATTTTGGTCCTTGTACTCACTACAACAACAACAAT
GCATTGTCTTCTCTCTTTGGATCGAATAGTGTTTCTTTGAATCGAAACCAGAGGAGATTGAATCGTGCTGCTAGCTCCGG
TGGAGCCATGGCAGTGATGGAGATGGAAAAGGAAGCTGCGGTTAACAAGAAACCACCTACGGAGCAGCGTCGAGTTGTAG
TGACAGGCATGGGAGTTGAAACATCATTGGGTCATGACCCACATACCTTCTATGAGAATTTGCTACAAGGCAACAGTGGT
ATTAGCCAGATTGAAAATTTTGATTGTTCTGAATTTCCTACGCGAATTGCGGGAGAGATCAAAAGCTTCTCGACTGAAGG
ATGGGTTGCTCCAAAACTTTCTAAAAGGATGGACAAATTCATGCTCTATCTTCTCACAGCTGGTAAGAAAGCTTTGGCTG
ATGGTGGGGTTACTGATGAAGTAATGGCAGAGTTTGACAAAACCAAATGTGGAGTTTTGATTGGCTCGGCAATGGGAGGA
ATGAAGGTCTTTTACGATGCTATTGAAGCTCTGAGAATCTCTTACAAGAAGATGAATCCTTTTTGTGTACCTTTTGCGAC
AACAAACATGGGTTCTGCTATGCTTGCCATGGATCTGGGATGGATGGGGCCAAACTATTCTATTTCAACTGCTTGTGCCA
CAAGCAACTTTTGCATTCTGAATTCAGCAAACCACATTATTAAAGGTGAAGCTGATGTAATGCTCTGTGGTGGCTCAGAT
GCAGTTATTATTCCAATAGGGTTGGGAGGTTTTGTTGCATGCCGGGCTCTTTCACAAAGGAATAATGATCCCACAAAAGC
TTCACGTCCTTGGGATACCAATCGAGATGGTTTCGTGATGGGAGAGGGAGCTGGAGTTCTACTTTTGGAAGAACTCGAGC
ATGCTAAGAAAAGAGGTGCAACTATCTACGCAGAGTTCCTCGGTGGGAGTTTCACATGTGATGCCTATCACATGACCGAG
CCTCACCCTGATGGGGCTGGTGTTATTCTCTGTATTGAGAGAGCGTTAGCTAGTGCTGGGATTTCCAAGGAACAAATAAA
TTACATAAATGCACATGCAACCTCAACGCATGCTGGAGATATTAAGGAATACCAAGCCCTTGCTCACTGTTTTGGCCAAA
ATCCTGAGCTTAAGGTAAATTCCACAAAATCTATGATTGGACACTTGCTGGGAGCTGCTGGGGCCGTGGAGGCTGTTGCA
ACTGTGCAGGCGATACGGACCGGATGGGTTCATCCAAATATCAACCTCGAGAATCCAGACAGTGGAGTGGATACAAAGCT
GCTGGTGGGTCCTAAGAAGGAGAGACTGGACATTAAAGCAGCCTTGTCAAATTCATTCGGGTTTGGTGGTCATAACTCCA
GCATCATTTTTGCTCCTTACAAGTGA