Details for Arabidopsis Locus AT1G74950

Position : Chr1 ( 5`- 28148575 .. 28150444 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74950

Protein [Map View]
MSSFSAECWDFSGRKPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQEDIKPK
TMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAE
VNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKP
TNPAWLSSR*

DNA
ATGTCGAGTTTTTCTGCCGAGTGTTGGGACTTCTCTGGTCGTAAACCGAGCTTTTCACAAACATGTACTCGATTGAGTCG
TTACCTGAAGGAGAAGGGTAGTTTTGGAGATCTGAGCTTAGGGATGACATGCAAGCCCGACGTTAATGGAGGTTCACGTC
AGCCTACAATGATGAATCTGTTCCCTTGTGAAGCTTCAGGAATGGATTCTTCTGCTGGTCAAGAAGACATTAAACCGAAG
ACTATGTTTCCGAGACAATCAAGCTTTTCTTCTTCCTCTTCCTCTGGGACCAAAGAAGATGTACAGATGATCAAAGAGAC
TACTAAATCTGTGAAGCCAGAGTCTCAATCTGCTCCGTTGACTATATTCTACGGTGGTCGAGTTATGGTGTTTGATGATT
TTTCTGCTGAGAAAGCTAAAGAAGTCATTGATTTGGCTAACAAAGGAAGTGCCAAAAGCTTCACATGTTTCACAGCTGAA
GTAAACAATAACCATAGTGCTTATTCTCAAAAAGAGATTGCTTCTAGCCCAAATCCTGTTTGTAGTCCTGCAAAAACCGC
AGCACAAGAGCCAATTCAGCCTAACCCGGCCTCTTTAGCCTGCGAACTCCCGATTGCAAGAAGAGCTTCACTTCATCGGT
TCCTTGAGAAGAGGAAGGATAGGATCACATCAAAGGCACCATACCAAATAGACGGTTCAGCTGAAGCGTCTTCCAAGCCT
ACTAACCCAGCTTGGCTCAGTTCACGGTAA