Details for Arabidopsis Locus AT1G74910

Position : Chr1 ( 5`- 28135361 .. 28138826 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74910

Protein [Map View]
MGSSMEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQIYLVGFYEEREFALYVSAISN
ELKVPVRYLREDKPHGSAGGLYHFRNLIMEDSPSHIFLLNCDVCCSFPLPKMLEAHRGYGGIGTLLVIKVSPESASQFGE
LVADPVTNELLHYTEKPETFVSDRINCGVYVFTPEIFNAIGDVSTQRKDRATLKRVSSFEALQPATRIPTDFVRLDQDIL
SPLAGKKRLYTYETMDFWEQIKSPGMSLRCSGLYLSQFRLTSPQLLASGDGTRSAIVIGDVYIHPSAKVHPTAKIGPNVS
ISANARVGPGVRLMSCIILDDVEIMENAVVTNAIVGWKSSIGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVL
PNKTLNVSVQDEIIL*

DNA
ATGGGGAGCTCAATGGAGGAGAAAGTGGTGGCTGTGATCATGGTCGGTGGTCCAACCAAAGGCACTCGATTTCGGCCATT
GTCGCTGAATATTCCAAAGCCTCTGTTTCCTATTGCGGGACAACCAATGGTGCATCATCCAATTTCAGCTTGTAAAAGAA
TTCCAAATTTAGCTCAAATATATCTTGTTGGCTTCTATGAGGAAAGGGAATTTGCACTTTATGTTTCAGCCATCTCTAAT
GAACTTAAAGTTCCTGTTAGATATCTGCGAGAAGACAAACCACATGGTTCAGCTGGTGGGCTGTATCACTTTAGAAATCT
TATTATGGAAGATAGTCCGTCTCATATCTTCCTGCTTAACTGTGATGTTTGCTGCAGTTTCCCCTTGCCCAAAATGCTCG
AGGCTCACAGGGGATATGGTGGAATTGGAACTCTTCTTGTGATCAAGGTCTCTCCTGAATCAGCCAGCCAATTTGGAGAA
TTGGTTGCAGATCCAGTTACTAATGAGCTGCTTCATTACACCGAGAAACCCGAAACTTTTGTCAGTGATCGAATTAACTG
TGGTGTTTATGTATTTACACCTGAAATTTTTAATGCCATAGGAGATGTTTCTACTCAGAGGAAAGATAGAGCAACTCTAA
AACGTGTTTCCAGCTTCGAAGCTCTTCAACCGGCAACAAGGATCCCGACAGATTTTGTAAGACTGGATCAAGACATCCTT
TCACCTCTAGCTGGGAAGAAACGGCTATATACTTATGAGACTATGGATTTCTGGGAGCAAATCAAATCTCCTGGGATGTC
GTTGAGGTGTTCAGGACTCTATCTTTCCCAATTCCGCTTGACATCTCCCCAACTGTTGGCTAGTGGTGATGGAACAAGGA
GTGCCATTGTGATTGGTGATGTTTACATACATCCTTCTGCAAAAGTTCACCCAACTGCAAAGATTGGTCCCAACGTCTCA
ATCTCTGCAAATGCTCGTGTTGGACCGGGCGTCAGGCTTATGAGCTGCATCATCCTTGACGATGTTGAGATCATGGAAAA
TGCAGTGGTGACTAACGCAATTGTTGGGTGGAAATCTTCTATCGGGAGATGGTCCCGCGTCCAGGCTGAGGGAGTCTACA
ATTCGAAACTCGGAGTTACAATTCTCGGAGACTCGGTTGCAGTTGAAGACGAGGTTGTGGTGACCAGCAGTATTGTTCTT
CCAAACAAGACACTGAACGTCAGTGTTCAAGACGAGATCATTTTGTAA