Details for Arabidopsis Locus AT1G74875

Position : Chr1 ( 5`- 28128470 .. 28129745 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74875

Protein [Map View]
MVNLGALNDEDKRKCANMFQIHLVINVLSSSLSEFRNLQLVSKSFKRISNDRYILQRLSLNKIPLLPWRNRKKFHNFFKR
CRKSGNLEAIYRKGLVDYFHRDSHERQRDRGLKHIAKTANNGNQEAQYVYGLILICLGGKTKQNGFKILSSLRKPLMLSN
TIKEMEKHRTHIRNMWWWGEPMMRHLQKSYVRENCNCDGRTEIFPNYCFRHRFGEDDDMLTSSACEICLCHHEVKLFFAN
IKE*

DNA
ATGGTAAATTTAGGTGCTCTAAACGACGAAGACAAGCGGAAGTGTGCCAACATGTTTCAAATTCACCTCGTAATCAATGT
ATTATCTTCATCATTATCCGAGTTTCGCAATCTTCAATTAGTTTCGAAATCGTTTAAACGTATCAGCAACGATCGATACA
TTCTGCAGCGGCTTTCCCTCAATAAAATCCCTCTTTTACCATGGCGCAACCGTAAAAAATTTCACAATTTTTTCAAAAGA
TGTCGCAAGAGTGGAAACCTAGAGGCTATATACCGTAAAGGACTTGTCGATTACTTTCATCGGGATAGTCATGAACGTCA
ACGAGACAGAGGACTCAAACATATAGCAAAAACTGCAAACAATGGAAATCAAGAAGCACAATATGTTTATGGGTTGATCC
TAATTTGTCTTGGTGGCAAAACAAAACAAAATGGTTTCAAGATCTTGTCTTCTCTACGAAAACCTTTGATGTTGTCAAAT
ACGATCAAGGAGATGGAAAAACATCGGACACATATCAGAAATATGTGGTGGTGGGGCGAACCGATGATGAGACACCTACA
AAAAAGCTATGTTCGTGAGAACTGCAATTGCGATGGTCGAACCGAGATCTTTCCCAACTATTGTTTTCGTCATCGTTTTG
GTGAGGACGACGACATGCTTACTTCTTCCGCTTGTGAGATATGTTTGTGCCATCATGAAGTCAAACTTTTCTTTGCTAAT
ATTAAGGAATGA