Details for Arabidopsis Locus AT1G74860

Position : Chr1 ( 5`- 28123319 .. 28125882 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74860

Protein [Map View]
MADPETLAALKRAYADTILNTTKEAAARVMVSEKKARRYQQELVTVRNEALHTLVRLKQMLDSKVKETEMQSLKQQQKVE
ELEAQLGEAEDIVGELRLELRVLHDELKKLTDGQKHLKKNHEENLCWNNRDAAVSVMPEVSCSHENTEAVGFCIPVEQNG
SVVANGIKVPSLTRINSINRCSYKDNKDQCHYTLPSILTKRRETEGLAQMIHTVDSSMANGVLSSSVEVGDVNDGVCLHE
VSSCKIVESLEMSGCADATDSISSVKDGEAPIVSPNSSQKDVGTLISLKTSPPREHENDRKLEISETEARKEEKESCENM
EVSASPLCEETPVLALSKNRCIKYTFKRKRKKEVLSNLEGDSSFEESRNMKQKTVEKDDGYLESLKPSFTSESSRDVVYA
*

DNA
ATGGCAGACCCAGAGACCTTAGCGGCGTTGAAGAGAGCCTACGCCGATACGATACTGAACACGACGAAGGAAGCGGCGGC
ACGTGTGATGGTTTCTGAGAAGAAGGCGCGTAGGTATCAGCAAGAACTTGTGACGGTTAGAAATGAAGCACTTCATACGT
TGGTTAGGCTTAAACAGATGCTTGATTCCAAGGTTAAGGAGACAGAGATGCAATCCTTGAAGCAGCAACAGAAGGTTGAG
GAACTTGAAGCTCAGCTTGGAGAAGCTGAAGATATTGTAGGAGAGCTGAGGTTGGAGTTGAGAGTACTTCACGATGAGCT
CAAGAAACTTACGGATGGTCAGAAACATCTTAAAAAGAATCATGAGGAAAACCTCTGTTGGAATAACCGTGATGCTGCAG
TTTCTGTAATGCCTGAGGTTTCTTGCAGTCACGAGAACACAGAAGCTGTAGGTTTTTGCATCCCAGTGGAACAAAATGGA
TCAGTGGTGGCTAATGGGATAAAAGTACCGTCTTTGACTCGCATAAATAGTATTAACCGGTGTTCTTATAAAGATAACAA
GGATCAATGTCACTACACTCTTCCATCTATACTGACAAAACGCAGGGAAACTGAAGGTTTAGCTCAGATGATCCACACAG
TAGATAGCAGTATGGCCAATGGGGTTCTGTCTTCCTCTGTAGAAGTAGGAGATGTGAATGATGGAGTATGTCTTCACGAA
GTTTCGTCTTGTAAAATTGTAGAGAGCTTAGAAATGTCTGGTTGTGCTGATGCTACTGACTCCATATCTTCTGTTAAAGA
TGGAGAAGCCCCAATAGTGTCTCCAAACTCTTCTCAGAAGGATGTCGGCACTCTTATATCCTTGAAAACATCTCCTCCGA
GGGAACATGAAAATGACAGAAAGCTGGAGATTAGCGAAACAGAGGCAAGGAAGGAAGAAAAAGAGAGCTGTGAGAATATG
GAGGTTTCTGCATCTCCTTTGTGCGAAGAAACTCCAGTTTTAGCACTGAGTAAAAATCGGTGCATCAAGTACACGTTCAA
GAGGAAGAGAAAGAAGGAGGTCTTAAGTAATCTTGAAGGAGATTCCTCGTTTGAGGAGAGTAGAAACATGAAACAGAAGA
CTGTTGAGAAAGACGATGGTTACTTGGAGTCTCTGAAGCCTAGCTTTACCAGTGAATCATCTAGAGATGTAGTCTATGCT
TAG