Details for Arabidopsis Locus AT1G74790

Position : Chr1 ( 5`- 28098765 .. 28101896 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74790

Protein [Map View]
MKLHQFLVFLFLFLSCFALSSWALPLCSDSRAPSEVNSTLSFCPYKGKTCCNTMKDTSLMKQFQAMNISDKGCASVVKSI
LCANCDPFSSDLFRDNSDQQSVPILCNSTSSANSTENFCSETWETCQNVSISGSLFAASLQGRAGAPSNKNASKLADLWQ
SKTDFCSAFGGASSNETVCFSGEPVALNDNDTTPDKPPSGICLEKIGNGSYLNMVPHPDGSNRAFFSTQPGIVFLAGIPD
QDSGGVLDVDPSSPFVDMTDEIHFDTEFGMMGMAFHPKFAQNGRFFASFNCDKSKWPGCTGRCSCNSDVNCDPSKLTPDS
GSQPCQYQTVIAEYTANSTSSDPSKAKNAKPTEVRRIFTMGLPFTSHHAGQILFGPDGYLYFMMGDGGGGADPYNFAQNK
KSLLGKIMRLDVDNIPSASEISKMGLWGNYSIPKDNPFREDKELEPEIWAVGLRNPWRCSFDSSRPSYFMCADVGQDTYE
EVDLISKGGNYGWRVYEGPDLFHPESSPGGNTSVKSLNPIFPVMGYNHSEVDSSGKSASITGGYFYRSETDPCIAGRYVY
ADLYGNGVWAGIETPANSGSFVTKRTTFSCASDSPMKCSDSPGTSGLSLGYVFSFGEDNNKDIYLLTSNGVYRVVRPSRC
NLTCSKENSTARRNPGTSSSPSSSSSSCYKHINGFHGSLVVLFVSLSLILLGLLN*

DNA
ATGAAGCTTCATCAATTTCTTGTGTTCCTTTTCTTGTTCCTCTCATGTTTTGCTCTTTCTTCATGGGCTCTTCCTCTCTG
TTCCGATTCAAGAGCTCCCTCGGAGGTGAATTCGACATTGAGCTTTTGTCCTTACAAAGGAAAAACATGCTGCAATACAA
TGAAAGATACCAGTTTGATGAAGCAATTTCAAGCTATGAACATTTCCGACAAGGGTTGTGCTTCTGTTGTAAAATCAATC
CTTTGTGCTAATTGCGATCCTTTTTCATCAGACTTATTCAGAGATAACTCAGATCAGCAGTCTGTTCCAATCCTCTGCAA
CTCGACCAGTTCAGCAAATTCCACAGAGAATTTTTGCTCTGAGACATGGGAGACATGTCAAAACGTCTCCATATCGGGTT
CTCTTTTCGCTGCCTCATTACAAGGCCGAGCTGGAGCGCCGTCAAATAAAAATGCCTCCAAGCTTGCTGATCTATGGCAG
TCCAAAACCGATTTCTGCAGTGCCTTTGGTGGAGCTAGCTCCAATGAAACTGTTTGCTTCAGCGGTGAGCCAGTTGCTCT
TAATGACAATGATACTACTCCTGACAAGCCGCCTTCTGGTATATGCCTTGAGAAAATTGGAAACGGTTCTTACCTCAACA
TGGTTCCTCACCCTGATGGCTCCAACCGTGCATTCTTCTCTACGCAACCTGGAATAGTATTCTTGGCTGGTATACCGGAT
CAAGATTCTGGCGGGGTTTTGGATGTGGATCCATCTAGCCCATTTGTGGATATGACTGATGAGATTCATTTTGATACTGA
GTTTGGGATGATGGGAATGGCTTTTCATCCAAAGTTTGCTCAAAATGGGCGTTTTTTCGCTTCTTTCAACTGCGATAAGT
CCAAGTGGCCAGGCTGTACTGGAAGGTGCTCATGTAACTCCGATGTGAACTGTGATCCTTCCAAACTAACTCCTGACAGT
GGATCTCAACCATGCCAATACCAAACCGTAATAGCTGAGTATACAGCCAATTCTACCTCGTCAGACCCTTCTAAGGCAAA
GAACGCTAAGCCAACAGAAGTCAGGAGGATTTTCACAATGGGACTTCCCTTCACATCACACCATGCTGGACAGATTCTCT
TTGGTCCAGATGGGTACCTATACTTTATGATGGGAGATGGAGGTGGAGGAGCAGACCCGTATAATTTCGCACAGAACAAG
AAATCTTTGCTAGGAAAGATCATGAGGCTTGATGTAGATAACATTCCTAGTGCTTCTGAGATCTCCAAAATGGGTCTATG
GGGAAACTACTCTATACCAAAAGACAACCCTTTTCGTGAAGACAAAGAGCTTGAACCTGAAATATGGGCTGTTGGATTGA
GAAACCCTTGGAGATGCAGCTTTGATTCTTCTAGGCCTTCTTACTTCATGTGTGCTGATGTTGGACAGGACACATATGAA
GAGGTGGATCTCATAAGCAAAGGAGGAAACTATGGTTGGCGTGTTTACGAAGGCCCGGATCTTTTCCATCCTGAGTCATC
CCCTGGAGGAAACACATCTGTTAAATCACTAAACCCGATATTTCCTGTGATGGGTTACAACCACTCAGAAGTTGACTCAA
GCGGAAAATCAGCTTCAATCACTGGAGGTTACTTTTATAGATCTGAAACTGATCCTTGCATAGCTGGAAGGTACGTATAT
GCTGATCTATATGGAAATGGCGTGTGGGCGGGGATTGAAACGCCTGCTAATAGCGGGAGCTTTGTGACCAAAAGAACAAC
CTTCAGCTGTGCCAGTGACTCACCCATGAAATGTAGTGATTCCCCGGGAACTTCAGGGCTCTCCCTAGGGTATGTCTTCT
CCTTTGGTGAGGATAACAACAAAGACATCTACTTGCTCACAAGCAATGGTGTCTATAGAGTAGTAAGGCCGAGCCGTTGC
AACTTGACTTGCTCCAAGGAAAACTCCACAGCTAGAAGAAACCCCGGTACCTCAAGTTCTCCTTCTTCTTCATCGTCTTC
TTGTTATAAGCATATAAATGGTTTCCATGGAAGCTTGGTGGTTTTGTTTGTGTCTCTGTCTTTGATTCTGCTAGGTTTAT
TAAACTAA