Details for Arabidopsis Locus AT1G74730

Position : Chr1 ( 5`- 28078857 .. 28079987 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74730

Protein [Map View]
MAVVGAPISSPAAQLQTQFLSNPILPRFRRSFSTGKSPATFSVVAMAPQKKVNKYDAKWKKQWYGAGLFFEGSEQINVDV
FKKLEKRKVLSNVEKSGLLSKAEGLGLTLSSLEKLKVFSKAEDLGLLSLLENLAGTSPAVLASAALPALTAAIVAVVLIP
DDSTTLVVAQAVLAGALALTGVVLLVGSVVLDGLQEAD*

DNA
ATGGCTGTCGTCGGCGCTCCAATATCGTCTCCGGCGGCTCAGCTGCAGACACAATTTCTCTCCAATCCCATTCTCCCCCG
CTTTCGCCGGTCTTTCTCCACCGGAAAATCACCAGCAACTTTCTCCGTCGTAGCTATGGCTCCCCAGAAAAAGGTGAACA
AATATGATGCCAAGTGGAAGAAACAATGGTACGGAGCTGGATTGTTTTTCGAAGGGAGTGAGCAAATAAACGTTGATGTT
TTCAAGAAGCTGGAGAAGCGAAAAGTGTTGAGCAACGTTGAGAAATCTGGCCTGCTGTCAAAAGCAGAGGGGTTGGGACT
CACATTGTCATCTCTTGAGAAGCTTAAAGTCTTCTCCAAAGCAGAGGACCTTGGTCTTCTCAGTCTCCTTGAGAACTTAG
CTGGAACATCGCCTGCGGTCTTAGCCTCGGCTGCATTACCAGCTCTCACGGCTGCTATTGTAGCCGTGGTGTTGATCCCG
GATGACTCAACTACTCTAGTGGTTGCTCAGGCGGTTTTGGCCGGTGCTCTTGCGCTTACAGGGGTTGTTTTGTTGGTTGG
TTCTGTTGTTTTGGATGGACTTCAAGAAGCTGACTGA