Details for Arabidopsis Locus AT1G74710

Position : Chr1 ( 5`- 28070295 .. 28074148 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74710

Protein [Map View]
MASLQFSSQFLGSNTKTHSSIISISRSYSPTPFTRFSRKKYESCSMSMNGCDGDFKTPLGTVETRTMTAVLSPAAATERL
ISAVSELKSQPPSFSSGVVRLQVPIDQQIGAIDWLQAQNEIQPRCFFSRRSDVGRPDLLLDLANENGNGNGNGTVSSDRN
LVSVAGIGSAVFFRDLDPFSHDDWRSIRRFLSSTSPLIRAYGGMRFDPNGKIAVEWEPFGAFYFSVPQVEFNEFGGSSML
AATIAWDDELSWTLENAIEALQETMLQVSSVVMKLRNRSLGVSVLSKNHVPTKGAYFPAVEKALEMINQKSSPLNKVVLA
RNSRIITDTDIDPIAWLAQLQREGHDAYQFCLQPPGAPAFIGNTPERLFQRTQLGVCSEALAATRPRAASSARDMEIERD
LLTSPKDDLEFSIVRENIREKLNGICDRVVVKPQKTVRKLARVQHLYSQLAGRLTKEDDEYKILAALHPTPAVCGLPAEE
ARLLIKEIESFDRGMYAGPIGFFGGEESEFAVGIRSALVEKGLGALIYAGTGIVAGSDPSSEWNELDLKISQVRAFVQKM
FSDIMVLCYQNPNFYSLFCCCFCSSPSQLNMKQQHLYRRLIEERVTFVFDCFVCMGDKGFSQ*

DNA
ATGGCTTCACTTCAATTTTCTTCTCAGTTTCTGGGCTCAAACACTAAAACACACAGCTCTATCATTTCCATCTCTCGTAG
TTACTCTCCAACTCCATTCACTAGATTCTCCCGCAAGAAGTATGAGTCATGTTCGATGTCTATGAATGGTTGTGATGGAG
ATTTCAAGACGCCACTTGGTACAGTGGAGACAAGGACTATGACTGCTGTTTTATCTCCGGCAGCCGCCACTGAAAGGCTA
ATCTCCGCCGTCTCTGAACTCAAATCTCAACCTCCGTCGTTTTCCTCCGGCGTCGTTCGGTTACAGGTTCCAATTGACCA
GCAAATCGGAGCAATTGATTGGCTTCAAGCCCAGAATGAGATTCAGCCTCGCTGTTTCTTCTCTCGTCGCAGTGACGTTG
GTCGTCCCGATCTTCTTCTCGATCTAGCTAACGAGAACGGAAACGGAAACGGAAACGGAACAGTGTCATCTGATCGTAAT
CTGGTTAGCGTTGCTGGTATCGGCTCTGCAGTTTTCTTCCGTGACCTTGATCCTTTCTCTCATGACGATTGGAGATCCAT
CAGAAGGTTTTTGTCTTCAACGTCACCTCTGATTCGTGCCTATGGTGGTATGCGTTTTGATCCTAATGGCAAGATCGCTG
TTGAATGGGAACCTTTTGGTGCATTTTACTTTTCAGTCCCTCAGGTTGAGTTTAATGAGTTTGGTGGAAGTTCAATGTTG
GCTGCAACTATTGCTTGGGATGATGAACTCTCTTGGACTCTGGAAAATGCTATTGAAGCACTCCAGGAGACTATGCTTCA
AGTTTCTTCTGTTGTAATGAAGTTGAGAAACAGATCTTTAGGAGTATCTGTTTTAAGCAAGAATCATGTTCCTACCAAAG
GAGCTTATTTCCCTGCTGTAGAGAAGGCTTTAGAGATGATTAACCAGAAAAGTTCACCCCTTAACAAGGTTGTTCTTGCT
CGTAACAGCAGGATAATTACGGATACCGACATTGATCCCATTGCTTGGCTAGCACAGTTACAGCGTGAAGGGCATGATGC
ATATCAGTTCTGTCTTCAACCACCTGGTGCACCAGCTTTTATCGGAAACACGCCTGAGAGACTATTCCAAAGGACTCAAT
TAGGTGTCTGCAGTGAAGCTTTGGCTGCAACTAGGCCTAGAGCTGCTTCTAGTGCTCGTGATATGGAGATAGAGCGTGAC
TTACTAACCAGTCCGAAAGACGACCTCGAGTTCTCTATCGTACGAGAGAATATAAGAGAAAAGTTAAACGGTATATGTGA
CAGAGTTGTTGTCAAGCCTCAAAAAACTGTGAGGAAGCTTGCAAGAGTGCAACATCTATATTCTCAATTGGCAGGGAGAC
TTACGAAGGAAGATGATGAGTATAAAATATTGGCTGCTCTGCATCCAACTCCAGCTGTTTGTGGGCTTCCAGCAGAAGAA
GCAAGGCTTTTGATTAAGGAGATAGAATCATTCGATAGAGGAATGTATGCGGGACCTATTGGATTTTTTGGTGGCGAGGA
GAGTGAATTTGCAGTCGGGATCAGATCAGCTCTAGTCGAAAAGGGTCTTGGGGCATTGATCTATGCGGGGACAGGGATAG
TAGCTGGAAGTGACCCATCTTCAGAGTGGAATGAGCTTGATCTTAAGATATCTCAGGTACGAGCTTTTGTCCAGAAAATG
TTTAGTGACATCATGGTTCTCTGTTACCAAAATCCTAATTTTTATTCTCTCTTTTGTTGTTGTTTTTGCAGTTCACCAAG
TCAATTGAATATGAAGCAACAACATCTCTACAGGCGATTAATTGAAGAAAGAGTAACATTTGTATTTGATTGTTTTGTTT
GTATGGGGGATAAGGGGTTCTCACAATAA