Details for Arabidopsis Locus AT1G74700

Position : Chr1 ( 5`- 28065266 .. 28067217 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74700

Protein [Map View]
MEKKKAMQIEGYPIEGLSIGGHETCIIFPSLRIAFDIGRCPHRAISQDFLFISHSHMDHIGGLPMYVATRGLYKMKPPTI
IVPASIKETVESLFEVHRKLDSSELKHNLVGLDIGEEFIIRKDLKVKAFKTFHVIQSQGYVVYSTKYKLKKEYIGLSGNE
IKNLKVSGVEITDSIITPEVAFTGDTTSDFVVDETNADALKAKVLVMESTFLDDSVSVEHARDYGHIHISEIVNHAEKFE
NKAILLIHFSARYTVKEIEDAVSALPPPLEGRVFALTQGF*

DNA
ATGGAGAAGAAGAAAGCAATGCAAATTGAAGGTTACCCGATCGAGGGATTGTCGATTGGTGGGCACGAGACGTGCATCAT
ATTTCCATCTCTTCGGATAGCTTTCGACATTGGTCGTTGCCCACATCGCGCAATTTCTCAAGACTTCCTCTTCATCTCTC
ACTCTCACATGGATCATATCGGTGGATTACCAATGTATGTTGCTACTAGAGGCTTGTACAAAATGAAGCCTCCAACGATT
ATAGTACCCGCATCCATTAAAGAAACTGTTGAGAGTTTATTCGAAGTTCACAGAAAGTTAGATTCTTCAGAGCTAAAGCA
CAATCTTGTTGGCTTGGACATAGGGGAGGAGTTTATTATAAGGAAAGATCTCAAAGTCAAAGCCTTTAAGACATTCCATG
TCATCCAAAGCCAGGGTTATGTAGTGTATTCAACTAAATATAAACTCAAGAAGGAATATATTGGCCTATCTGGAAATGAA
ATTAAGAACTTGAAGGTTTCAGGTGTTGAGATTACAGACAGCATAATAACTCCTGAAGTTGCTTTTACGGGAGATACAAC
GTCGGATTTTGTAGTTGATGAAACTAATGCTGATGCTCTCAAGGCAAAGGTTCTCGTCATGGAGAGCACATTTCTTGATG
ATTCGGTATCGGTAGAGCATGCGAGAGATTATGGACATATCCATATATCTGAGATAGTAAATCATGCTGAAAAGTTTGAA
AACAAAGCAATCCTGCTAATCCACTTTTCGGCTCGGTATACAGTGAAGGAAATCGAAGATGCGGTTTCTGCATTGCCTCC
ACCTTTAGAGGGACGTGTGTTTGCACTAACACAAGGATTCTAA