Details for Arabidopsis Locus AT1G74690

Position : Chr1 ( 5`- 28061159 .. 28064625 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74690

Protein [Map View]
MGKSTKWLKNVLLGKKTSKSSGSKDKERVVSGKEVLVTSKVEESDVVSDLPSFEVAETNTVDRSGGMLETQNVGPEEISD
DEIELPEGKSTDSQNVAPVQDHSLSDAERIQREIAATSVQAAFRGYLARRAFWALKGIIRLQALIRGHLVRRQAVATLFS
VMGIVRLQAFARGREIRKSDIGVQVYRKCRLQLLQGNKLANPTDAYLGIKKLTANAFAQKLLASSPKVLPVHAYDTSNPN
SNLIWLENWSASCFWKPVPQPKKTISRKPQNRLLVEAESAKPKKSVRKVPASNFESSSVQTSFEFEKPKRSFRKVSSQSI
EPPAVEDPQIELEKVKRSLRKVHNPVVESSIQPQRSPRKEVEKPKLGVEKTRESSYPLVHETAEEPVNVCDEKKKQEISE
QPEEEVHALEMEVHTPGPLETNEALDSSLVNQIDSNEKAMVEEKPSMEKDTKEEKTPKPNNKENSAGKENQKSRKKGSAT
SKTEREESNGHHETSPSIPSYMQATKSAKAKLRLQGSPKSAEQDGTEKATVPRRHSLPSPGNGRITSHSPRTTRLANSGD
KTGNKKEKPLLSSREGNAKTTPAERKR*

DNA
ATGGGGAAGTCTACAAAATGGTTGAAGAATGTATTGCTTGGGAAAAAAACTTCTAAATCTAGTGGTTCCAAAGACAAAGA
GAGAGTTGTGAGTGGAAAAGAGGTACTGGTTACTTCAAAGGTGGAAGAATCAGATGTGGTATCAGATCTTCCATCTTTTG
AAGTTGCAGAGACCAATACCGTTGATAGAAGTGGTGGTATGTTAGAGACTCAAAATGTAGGACCTGAAGAGATCTCAGAT
GATGAAATTGAGCTTCCTGAAGGAAAATCAACAGATTCTCAGAATGTTGCACCTGTTCAAGATCATTCATTATCTGATGC
AGAGAGAATCCAACGAGAGATTGCAGCAACGTCTGTGCAGGCTGCGTTTAGAGGTTACTTGGCTCGGCGTGCTTTTTGGG
CACTCAAAGGCATAATAAGGCTACAAGCGCTTATCCGTGGTCACCTTGTTAGGAGACAAGCTGTTGCAACTCTTTTCTCT
GTCATGGGAATTGTCAGGTTGCAAGCATTTGCTCGAGGAAGAGAGATCAGGAAGTCCGACATTGGAGTTCAAGTTTATAG
GAAATGCAGATTGCAGCTACTTCAGGGGAACAAGCTTGCAAATCCTACAGATGCTTACCTTGGAATCAAGAAACTAACAG
CCAATGCTTTTGCTCAGAAGCTTCTCGCTTCATCACCAAAAGTGCTACCTGTACACGCATATGATACATCCAATCCAAAC
TCAAACTTGATCTGGTTAGAGAACTGGTCAGCCTCATGCTTCTGGAAACCAGTTCCTCAACCGAAGAAAACGATAAGCAG
AAAACCTCAGAACAGGCTTTTAGTCGAGGCTGAGTCTGCTAAACCCAAGAAGAGTGTCCGTAAAGTTCCTGCTTCAAACT
TTGAAAGTTCCTCAGTACAGACATCTTTTGAGTTTGAGAAACCCAAACGCAGTTTCCGGAAAGTTTCAAGCCAGTCGATA
GAGCCACCCGCTGTCGAAGATCCTCAGATTGAACTTGAAAAGGTTAAACGTAGCTTGAGGAAGGTACATAATCCTGTAGT
TGAGAGCTCTATCCAACCTCAACGATCCCCTCGTAAGGAAGTCGAGAAGCCAAAGCTTGGCGTTGAGAAGACAAGGGAAT
CATCATATCCGCTGGTTCATGAAACTGCAGAAGAACCTGTGAATGTTTGTGATGAAAAGAAAAAGCAAGAAATTTCCGAA
CAGCCTGAGGAGGAGGTACATGCTCTTGAGATGGAAGTACATACTCCTGGACCATTAGAAACTAATGAAGCACTTGATTC
CTCACTGGTCAACCAAATTGACAGCAATGAAAAAGCCATGGTTGAGGAAAAACCCTCAATGGAAAAGGATACCAAAGAAG
AAAAGACTCCCAAACCAAACAATAAAGAGAATTCCGCTGGGAAGGAGAACCAGAAATCCAGGAAAAAGGGTTCAGCTACT
AGCAAGACTGAGCGTGAAGAGAGTAATGGGCATCACGAGACTAGCCCATCAATCCCAAGCTATATGCAAGCAACTAAATC
GGCGAAAGCAAAGCTAAGGCTTCAAGGCTCACCAAAGTCTGCGGAGCAAGATGGAACTGAGAAAGCCACTGTTCCCAGAC
GTCACTCTCTACCATCTCCAGGTAATGGTAGGATCACTTCTCACTCTCCAAGAACAACGAGACTCGCAAACTCAGGTGAC
AAAACCGGGAATAAGAAGGAGAAACCTCTTCTGTCGTCCCGAGAAGGAAACGCCAAGACAACTCCAGCAGAGCGGAAGAG
GTGA