Details for Arabidopsis Locus AT1G74670

Position : Chr1 ( 5`- 28053286 .. 28054149 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74670

Protein [Map View]
MAKLITSFLLLTILFTFVCLTMSKEAEYHPESYGPGSLKSYQCGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYG
NKQVCPCYNNWKTQQGGPKCP*

DNA
ATGGCCAAACTCATAACTTCTTTTCTCTTACTCACAATTTTATTCACTTTCGTTTGTCTCACTATGTCAAAAGAAGCTGA
GTACCATCCAGAAAGTTATGGACCAGGAAGTCTGAAATCATACCAATGTGGAGGACAATGCACAAGGAGATGTAGCAACA
CAAAGTATCATAAGCCATGCATGTTCTTCTGCCAAAAGTGTTGTGCTAAATGCCTTTGTGTCCCTCCAGGCACGTACGGC
AACAAACAAGTGTGTCCTTGTTACAACAACTGGAAGACTCAACAAGGTGGACCAAAATGTCCATAA