Details for Arabidopsis Locus AT1G74650

Position : Chr1 ( 5`- 28041191 .. 28042995 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74650

Protein [Map View]
MGRPPCCEKIEVKKGPWTPEEDIILVSYIQQHGPGNWRSVPANTGLLRCSKSCRLRWTNYLRPGIKRGNFTQPEEKMIIH
LQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLVMMKFQNGIINENKTNLATDISSCNNNNNGCNHNKRTTNKGQWE
KKLQTDINMAKQALFQALSLDQPSSLIPPDPDSPKPHHHSTTTYASSTDNISKLLQNWTSSSSSKPNTSSVSNNRSSSPG
EGGLFDHHSLFSSNSESGSVDEKLNLMSETSMFKGESKPDIDMEATPTTTTTDDQGSLSLIEKWLFDDQGLVQCDDSQED
LIDVSLEELK*

DNA
ATGGGTAGACCACCTTGTTGCGAGAAGATTGAGGTGAAGAAAGGACCATGGACTCCCGAAGAAGACATAATCTTGGTCTC
TTATATCCAACAACACGGCCCTGGAAATTGGAGATCTGTCCCTGCAAACACCGGTTTGCTAAGGTGTAGCAAGAGTTGCA
GACTTAGATGGACTAATTACCTTCGTCCCGGGATCAAACGAGGAAATTTCACTCAACCGGAAGAGAAGATGATCATCCAC
CTTCAAGCTCTTTTGGGAAATAGATGGGCAGCTATAGCATCATATCTACCTCAGAGGACCGACAATGATATCAAGAACTA
CTGGAACACTCATCTTAAAAAGAAACTAGTGATGATGAAGTTTCAAAATGGTATCATCAACGAAAACAAAACCAATCTGG
CAACAGATATTTCGTCTTGTAATAATAACAACAATGGATGTAATCACAACAAAAGGACCACCAACAAAGGCCAATGGGAG
AAAAAACTTCAAACAGACATCAACATGGCCAAACAAGCCTTATTCCAAGCCTTGTCACTTGACCAACCATCTTCATTGAT
CCCTCCCGATCCTGACTCACCAAAACCTCATCATCATTCTACCACCACTTATGCCTCAAGCACAGATAACATCTCTAAAT
TACTCCAGAACTGGACAAGCTCATCATCGTCAAAGCCTAACACTTCATCAGTCTCCAACAACCGGAGCTCAAGCCCCGGT
GAAGGAGGACTTTTTGATCATCACTCTTTGTTCTCATCGAATTCAGAATCTGGATCAGTTGATGAGAAGCTGAATTTGAT
GTCCGAGACAAGCATGTTCAAAGGTGAGAGCAAGCCAGACATAGACATGGAAGCTACACCTACTACTACTACTACTGATG
ATCAAGGCTCGTTGTCATTGATCGAGAAATGGTTGTTTGATGATCAAGGCTTGGTTCAGTGTGATGATAGTCAAGAAGAT
CTCATCGACGTGTCTTTAGAGGAGTTAAAATAA