Details for Arabidopsis Locus AT1G74590

Position : Chr1 ( 5`- 28023627 .. 28024726 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74590

Protein [Map View]
MEEKKSKVILHGTWISTYSKRVEIALKLKGVLYEYLEEDLQNKSESLIQLNPVHKKIPVLVHDGKPVAESLVILEYIDET
WTNSPRFFPEDPYERAQVRFWVSYINQQVFEVMGQVMSQEGEAQAKSVEEARKRFKVLDEGLKKHFPNKNIRRNDDVGLL
EITIIATLGGYKAHREAIGVDIIGPVNTPTLYNWIERLQDLSVIKEVEVPHDTLVTFIQKYRQKCLQQAANA*

DNA
ATGGAGGAGAAGAAGAGCAAAGTGATATTACATGGGACGTGGATAAGCACATACTCAAAGAGGGTCGAAATCGCTCTTAA
ACTCAAGGGTGTACTCTACGAGTACCTCGAAGAAGATCTTCAGAACAAAAGTGAATCGCTGATTCAACTCAACCCGGTGC
ACAAGAAGATTCCTGTTCTTGTCCATGATGGGAAACCAGTGGCTGAATCACTTGTGATTCTTGAATATATCGATGAGACG
TGGACAAACTCTCCTCGTTTCTTCCCAGAGGATCCTTATGAAAGGGCCCAGGTCCGGTTCTGGGTCAGCTACATCAACCA
ACAGGTGTTTGAGGTCATGGGTCAAGTCATGTCCCAGGAGGGTGAAGCTCAAGCAAAGTCTGTAGAAGAGGCAAGAAAAA
GATTCAAAGTTCTTGATGAGGGACTCAAGAAGCATTTCCCGAATAAAAACATCAGAAGGAATGATGATGTTGGGCTTTTG
GAAATCACCATCATTGCTACTCTCGGAGGCTACAAAGCTCATCGTGAAGCAATCGGTGTAGACATAATTGGTCCAGTGAA
CACTCCGACTTTATACAACTGGATAGAGCGCCTGCAAGATCTAAGTGTGATAAAAGAAGTCGAAGTGCCTCATGATACGT
TGGTGACATTTATCCAGAAGTATAGACAAAAGTGTCTCCAGCAGGCTGCAAATGCATAA