Details for Arabidopsis Locus AT1G74520

Position : Chr1 ( 5`- 28007974 .. 28009300 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74520

Protein [Map View]
MGSGAGNFLKVLLRNFDVLAGPVVSLVYPLYASVQAIETQSHADDKQWLTYWVLYSLLTLIELTFAKLIEWLPIWSYMKL
ILTCWLVIPYFSGAAYVYEHFVRPVFVNPRSINIWYVPKKMDIFRKPDDVLTAAEKYIAENGPDAFEKILSRADKSKRYN
KHEYESYETMYGEGYQY*

DNA
ATGGGATCTGGAGCTGGCAATTTCCTCAAGGTTCTTCTCAGGAACTTCGATGTTCTTGCTGGGCCTGTGGTTAGTCTCGT
TTATCCTCTATATGCTTCAGTTCAAGCGATTGAAACTCAATCTCATGCTGATGACAAACAATGGCTAACTTATTGGGTCC
TTTATTCATTACTTACACTCATCGAGCTCACATTCGCCAAACTCATCGAATGGTTACCGATATGGTCATACATGAAGCTG
ATCTTGACTTGCTGGCTTGTTATTCCCTACTTTAGTGGCGCTGCTTATGTCTATGAACATTTTGTGAGACCGGTGTTTGT
TAACCCTCGGAGCATTAACATTTGGTATGTGCCAAAGAAGATGGATATCTTCAGAAAACCAGACGATGTGTTAACAGCTG
CTGAGAAGTACATTGCAGAGAATGGACCTGATGCTTTTGAGAAGATCTTAAGCCGGGCTGATAAATCAAAAAGATATAAT
AAGCATGAATATGAAAGCTATGAAACGATGTATGGTGAGGGTTATCAGTACTAA