Details for Arabidopsis Locus AT1G74510

Position : Chr1 ( 5`- 28005365 .. 28007739 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74510

Protein [Map View]
MLEAPSYLVSRDLPSSCEEESKWIYNAHCVLQLSLRKRLLDDTDVEGSSAKKMLRVDHGSRGESDKITDSLQLAKTYQSS
NQSQQGGGGDQQSSPVTRLDQNALLNCLAHCSLSDFGSIASTNRTFRSLIKDSELYRLRRAKGIVEHWIYFSCRLLEWEA
YDPNGDRWLRVPKMTFNECFMCSDKESLAVGTELLVFGKEIMSHVIYRYSILTNTWTSGMQMNVPRCLFGSASLGEIAVI
AGGCDPRGRILSSAELYNSETGEWTVIPSMNKARKMCSSVFMDGNFYCIGGIGEGNSKMLLCGEVYDLKKKTWTLIPNML
PERSSGGGGDQAKEIAAATAASEAPPLVAVVKDELYAANYAQQEVKKYDKRLNVWNKVGNLPERASSMNGWGMAFRACGD
QLVVVGGPRAIGGGFIEINACVPSEGTQLHWRVLASKPSGNFVYNCAVMGC*

DNA
ATGTTGGAGGCTCCGAGTTATCTGGTGTCAAGGGACTTACCATCTTCATGTGAGGAAGAGAGCAAGTGGATATACAATGC
ACACTGTGTGCTTCAGCTCTCCCTAAGGAAGCGTTTGTTGGATGATACTGATGTAGAAGGAAGTTCCGCTAAGAAAATGT
TACGGGTTGATCATGGAAGCAGAGGTGAATCTGACAAGATTACAGATAGTCTTCAGCTTGCTAAAACCTATCAGAGCTCT
AACCAGAGTCAACAAGGTGGTGGTGGTGATCAACAGAGTTCACCAGTTACTCGGCTTGACCAAAACGCGCTTCTCAACTG
CTTGGCTCACTGTTCGTTATCTGATTTCGGGTCTATAGCGTCGACGAATAGAACCTTCCGCTCGTTGATTAAGGACAGCG
AGTTGTATAGGTTGAGACGGGCAAAGGGTATTGTGGAGCATTGGATTTACTTCTCTTGCAGGCTCTTAGAATGGGAGGCT
TATGATCCTAATGGAGATCGCTGGTTACGTGTACCGAAAATGACATTCAACGAGTGTTTCATGTGTTCGGATAAAGAGTC
TCTGGCGGTTGGCACCGAGCTTCTTGTTTTCGGAAAAGAGATCATGTCTCATGTGATTTACCGATATAGCATCTTAACCA
ATACATGGACATCGGGTATGCAAATGAATGTCCCGAGGTGCTTGTTTGGATCAGCGAGTCTAGGCGAGATCGCGGTTATA
GCTGGAGGATGTGATCCGCGTGGGAGGATACTGAGTTCTGCAGAGCTTTATAACTCTGAAACTGGGGAATGGACGGTCAT
CCCGAGCATGAACAAAGCGAGGAAAATGTGCTCGAGCGTGTTCATGGATGGGAATTTCTATTGCATTGGAGGTATCGGAG
AGGGAAACTCGAAGATGCTATTGTGCGGTGAAGTCTATGATCTGAAGAAGAAGACATGGACATTGATACCTAACATGTTA
CCTGAAAGAAGCAGTGGAGGTGGAGGAGATCAAGCAAAAGAGATTGCTGCTGCAACAGCGGCTTCAGAGGCTCCACCGCT
TGTAGCAGTTGTAAAAGACGAGCTTTATGCTGCGAATTACGCGCAGCAAGAGGTGAAGAAATACGATAAAAGGCTTAATG
TATGGAATAAGGTAGGGAATTTGCCAGAGAGGGCTTCTTCGATGAACGGTTGGGGAATGGCGTTTAGGGCTTGTGGGGAT
CAGTTAGTGGTGGTTGGAGGACCTAGGGCAATAGGAGGAGGGTTTATAGAGATCAATGCTTGTGTCCCAAGTGAAGGAAC
ACAACTGCATTGGAGAGTTCTTGCTTCTAAGCCATCGGGAAACTTTGTGTATAATTGTGCGGTGATGGGATGTTGA