Details for Arabidopsis Locus AT1G74500

Position : Chr1 ( 5`- 27998175 .. 27998821 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74500

Protein [Map View]
MSGRRSRSRQSSGTSRISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELLANSD
TAQAALIRSLLTQ*

DNA
ATGTCGGGAAGAAGATCACGTTCGAGGCAATCATCAGGAACTTCAAGGATCTCAGAAGATCAAATCAATGATCTGATTAT
CAAGTTGCAACAGCTTCTTCCTGAGCTCAGGGACAGTCGTCGTTCCGACAAGGTTTCAGCAGCGAGGGTGTTACAAGATA
CGTGCAACTACATACGGAATCTGCATAGAGAGGTTGATGATCTAAGTGAGAGGCTATCTGAGTTACTAGCAAACTCAGAC
ACTGCACAAGCTGCTTTAATCAGAAGCTTACTTACCCAATAA