Details for Arabidopsis Locus AT1G74480

Position : Chr1 ( 5`- 27993032 .. 27994178 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74480

Protein [Map View]
MADHTTKEQKSFSFLAHSPSFDHSSLSYPLFDWEEDLLALQENSGSQAFPFTTTSLPLPDLEPLSEDVLNSYSSASWNET
EQNRGDGASSEKKRENGTVKETTKKRKINERHREHSVRIISDITTYTTSSAPTTLSKETVSRYFYMPITQAAIALNVGLT
LLKRRCRELGIRRWPHRKLMSLNTLISNVKELQKMEGEENAEKLQDALEMLEKEKRTIEDLPDLEFKDKTKRLRQACFKA
NHKRKKKRSLKSDQSQVPSCSSSGSVPSDESVDEAGMESDEEMKYLLCGFSSEFTSGL*

DNA
ATGGCTGATCACACAACCAAAGAACAGAAGTCATTCTCATTCCTAGCTCATTCTCCATCCTTTGATCACAGCTCCTTAAG
TTATCCTTTATTCGACTGGGAAGAAGATCTTCTTGCTCTCCAAGAAAACTCTGGCTCTCAAGCATTTCCTTTTACTACAA
CTTCTCTGCCTTTACCTGATCTTGAACCCTTGTCTGAAGATGTACTCAATTCATACAGCTCTGCGTCATGGAACGAAACA
GAGCAAAACAGAGGAGATGGCGCTTCATCGGAGAAGAAGAGGGAAAATGGAACAGTGAAAGAGACAACTAAGAAGAGGAA
AATCAATGAGAGACACAGAGAACATAGCGTGAGAATCATCAGCGATATTACTACCTACACAACTAGTTCAGCTCCAACGA
CATTGTCAAAGGAAACTGTCTCTCGCTACTTCTACATGCCCATAACTCAGGCTGCAATAGCACTTAACGTTGGTTTAACT
CTACTAAAAAGGAGATGTCGCGAATTGGGTATTCGCCGATGGCCTCATCGTAAACTTATGAGCTTAAACACTTTGATCAG
TAACGTCAAGGAGCTGCAGAAGATGGAAGGCGAAGAGAATGCAGAAAAACTGCAGGACGCGTTGGAGATGCTTGAGAAGG
AGAAGAGGACAATTGAGGATTTGCCGGATTTGGAGTTTAAGGACAAGACAAAGAGGCTAAGACAAGCTTGTTTCAAGGCT
AACCACAAGAGGAAGAAGAAGAGAAGTCTCAAGTCCGATCAGTCTCAAGTACCCTCGTGTTCAAGCAGCGGATCAGTTCC
TAGTGATGAGTCGGTTGATGAAGCAGGAATGGAGAGTGATGAAGAAATGAAGTATCTCTTGTGTGGTTTCTCAAGTGAAT
TTACTAGTGGTTTGTGA