Details for Arabidopsis Locus AT1G74470

Position : Chr1 ( 5`- 27991165 .. 27993006 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74470

Protein [Map View]
MATTVTLKSFTGLRQSSTEQTNFVSHVPSSLSLPQRRTSLRVTAARATPKLSNRKLRVAVIGGGPAGGAAAETLAQGGIE
TILIERKMDNCKPCGGAIPLCMVGEFNLPLDIIDRRVTKMKMISPSNIAVDIGRTLKEHEYIGMVRREVLDAYLRERAEK
SGATVINGLFLKMDHPENWDSPYTLHYTEYDGKTGATGTKKTMEVDAVIGADGANSRVAKSIDAGDYDYAIAFQERIRIP
DEKMTYYEDLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKGDIKKFQLATRNRAKDKILGGKIIRVEAHPIPEHPR
PRRLSKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIVEGSQNGKKMIDEGDLRKYLEKWDKTYLPTYRVLDVLQKV
FYRSNPAREAFVEMCNDEYVQKMTFDSYLYKRVAPGSPLEDIKLAVNTIGSLVRANALRREIEKLSV*

DNA
ATGGCGACGACGGTTACACTCAAATCCTTCACCGGACTTCGTCAATCATCAACGGAGCAAACAAACTTCGTCTCTCATGT
ACCGTCATCACTTTCTCTCCCTCAACGACGGACCTCTCTCCGAGTAACCGCAGCCAGAGCCACTCCCAAACTCTCCAACC
GTAAACTCCGTGTCGCCGTCATCGGTGGTGGACCAGCAGGCGGGGCAGCTGCAGAGACTCTAGCACAAGGAGGAATCGAG
ACGATTCTCATCGAGCGTAAGATGGACAATTGCAAGCCTTGCGGTGGCGCGATTCCTCTCTGTATGGTCGGAGAATTCAA
CTTGCCGTTGGATATTATTGATCGGAGAGTGACGAAGATGAAGATGATTTCGCCGTCGAACATTGCTGTTGATATTGGTC
GTACGCTTAAGGAGCATGAGTATATAGGTATGGTGAGAAGAGAAGTTCTTGATGCTTATCTGAGAGAGAGAGCTGAGAAG
AGTGGAGCCACTGTGATTAACGGTCTCTTCCTTAAGATGGATCATCCGGAGAATTGGGACTCGCCGTACACTTTGCATTA
CACTGAGTACGATGGTAAAACTGGAGCTACAGGGACGAAGAAAACAATGGAGGTTGATGCTGTCATTGGAGCTGATGGAG
CTAACTCTAGGGTTGCTAAATCTATTGATGCTGGTGATTACGACTACGCAATTGCATTTCAGGAGAGGATTAGGATTCCT
GATGAGAAAATGACTTACTATGAGGATTTAGCTGAGATGTATGTTGGAGATGATGTGTCGCCGGATTTCTATGGTTGGGT
GTTCCCTAAGTGCGACCATGTAGCTGTTGGAACAGGTACTGTGACTCACAAAGGTGACATCAAGAAGTTCCAGCTCGCGA
CCAGAAACAGAGCTAAGGACAAGATTCTTGGAGGGAAGATCATCCGTGTGGAGGCTCATCCGATTCCTGAACATCCGAGA
CCACGTAGGCTCTCGAAACGTGTGGCTCTTGTAGGTGATGCTGCAGGGTATGTGACTAAATGCTCTGGTGAAGGGATCTA
CTTTGCTGCTAAGAGTGGAAGAATGTGTGCTGAAGCCATTGTCGAAGGTTCACAGAATGGTAAGAAGATGATTGACGAAG
GGGACTTGAGGAAGTACTTGGAGAAATGGGATAAGACATACTTGCCTACCTACAGGGTACTTGATGTGTTGCAGAAAGTG
TTTTACAGATCAAATCCGGCTAGAGAAGCGTTTGTGGAGATGTGTAATGATGAGTATGTTCAGAAGATGACATTCGATAG
CTATCTGTACAAGCGGGTTGCGCCGGGTAGTCCTTTGGAGGATATCAAGTTGGCTGTGAACACCATTGGAAGTTTGGTTA
GGGCTAATGCTCTAAGGAGAGAGATTGAGAAGCTTAGTGTTTAA