Details for Arabidopsis Locus AT1G74340

Position : Chr1 ( 5`- 27948123 .. 27951668 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74340

Protein [Map View]
MELADRAVGLLLSSISLSIFTYYTFWVIILPFVDSDHFIHKYFLPQDYAILVPVFAGIALLSLISVFIGMVMLKSKKKKA
*

DNA
ATGGAATTAGCGGATCGAGCAGTCGGGCTTCTACTATCTTCAATCAGCTTGTCCATATTCACGTACTATACTTTTTGGGT
CATCATCCTGCCATTTGTAGATAGTGATCACTTCATCCACAAGTACTTCTTACCCCAAGACTATGCCATTCTCGTACCTG
TCTTTGCCGGCATAGCTCTTCTCTCTCTCATTTCCGTATTCATCGGCATGGTCATGCTCAAATCCAAAAAGAAGAAGGCT
TAA