Details for Arabidopsis Locus AT1G74250

Position : Chr1 ( 5`- 27920328 .. 27922414 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74250

Protein [Map View]
MASSSRSEKRCHYEVLGISKESSPDEIRSSYRRLALQRHPDKLMKAAGLSEAEATAQFQELVHAYEVLSDPKERAWYDSH
RSQILFADHSSAGGSKSGGSVPDLFAFFSPTVYSGYSDTGKGFYKVYYDVFNSVYLNEIKFARTLGLRMDSVREAPIMGN
LESPYAQVTAFYNYWLGFCTVMDFCWVDEYDVMGGPNRKSRRMMEEENKKSRKKAKREYNDTVRGLAEFVKKRDKRVIDM
LVKKNAEMEKKKEEERERKKKMEKERLERAMNYEEPEWAKAHEGEDEGAGLSELEEEDDDAKRKNEQLYCIVCSKKFKSE
KQWKNHEQSKKHKEKVAELRESFTDYEEENEEEEIDGPLDSPESVEELHEKLQEELNIDNEERDVKKEVVGEADETDDEY
FVAEEDMQGSSESEDEDDEMTLLKKMVSGQKNKQKNVVSKEEDEDETEVEIEGDTAEFSEFDNQKSTGRNKEAKEERNKQ
NAGNDMADDTSKVQIPGEGGNPDENMNATESASGALADSQKDEANSMEYDNRKSTGRRRRSKKGKDKNNQGELNEKSSEA
DDTQYVNRDMESQDYKKAPRSKKSTRGMKTKGTTKKNSSNECDRCGEEFESRTKLHKHLADSGHATVKSR*

DNA
ATGGCGTCTTCGTCTCGTTCGGAGAAACGATGTCACTACGAGGTTCTCGGTATCAGCAAGGAATCTTCGCCGGACGAGAT
TCGATCCTCTTATCGGCGTTTAGCTCTGCAGCGTCACCCCGACAAGCTAATGAAAGCCGCTGGATTATCGGAGGCTGAAG
CCACCGCCCAGTTCCAAGAGCTCGTTCACGCTTACGAGGTTCTATCCGATCCCAAGGAGCGAGCCTGGTATGATTCTCAT
CGATCTCAGATTTTATTTGCTGACCATAGTTCAGCCGGTGGCTCGAAGTCTGGTGGCTCTGTTCCGGATCTATTCGCTTT
CTTCTCTCCCACTGTATATTCTGGATACTCAGATACCGGGAAAGGATTTTACAAGGTGTATTACGATGTGTTTAATAGTG
TTTACCTCAACGAGATTAAGTTCGCGAGAACGTTAGGTTTGAGGATGGATTCTGTGAGGGAAGCTCCGATTATGGGGAAT
CTAGAGTCTCCTTATGCTCAGGTGACGGCGTTTTATAATTACTGGTTAGGTTTTTGCACTGTTATGGATTTCTGCTGGGT
GGATGAGTATGATGTGATGGGTGGACCGAATCGAAAGTCGAGAAGGATGATGGAGGAGGAGAATAAAAAGTCGAGAAAGA
AGGCGAAGAGAGAGTATAATGATACTGTGAGGGGTTTGGCAGAGTTTGTGAAGAAGAGGGATAAGAGAGTGATTGACATG
TTGGTGAAGAAGAATGCAGAGATGGAGAAGAAGAAGGAAGAGGAGAGGGAAAGGAAGAAGAAGATGGAGAAGGAGAGATT
GGAGAGAGCTATGAATTACGAGGAGCCTGAATGGGCAAAGGCTCATGAGGGAGAAGATGAAGGGGCAGGACTCAGTGAAT
TGGAAGAGGAGGATGATGATGCGAAGAGGAAGAATGAGCAGCTCTATTGTATTGTTTGTAGCAAGAAGTTCAAAAGTGAG
AAGCAGTGGAAAAACCACGAACAGTCGAAGAAGCATAAAGAGAAAGTGGCGGAGCTGAGAGAGTCATTCACTGATTATGA
AGAGGAAAATGAAGAGGAAGAGATTGATGGGCCCTTGGACTCACCTGAAAGTGTAGAGGAGCTGCATGAGAAGCTTCAGG
AGGAGTTAAATATCGACAATGAAGAAAGAGATGTTAAGAAGGAAGTTGTAGGTGAAGCTGATGAAACTGATGATGAGTAT
TTTGTGGCAGAGGAAGATATGCAAGGATCTAGTGAAAGTGAGGATGAGGATGACGAGATGACTCTACTCAAGAAAATGGT
ATCTGGACAGAAGAATAAGCAAAAGAATGTCGTATCAAAGGAAGAAGATGAAGATGAAACTGAAGTCGAGATCGAAGGTG
ACACAGCAGAGTTTAGCGAATTTGATAACCAGAAAAGCACAGGTAGGAATAAAGAAGCTAAGGAAGAGAGAAATAAACAG
AATGCTGGAAATGACATGGCAGATGACACCAGCAAAGTACAGATACCTGGAGAGGGCGGTAATCCAGATGAAAACATGAA
TGCAACGGAGTCAGCTTCCGGAGCACTTGCGGATTCTCAGAAGGATGAGGCAAATTCAATGGAGTATGATAATAGGAAGA
GCACAGGCAGGAGGCGCAGAAGCAAAAAGGGCAAGGATAAGAATAACCAGGGAGAATTAAATGAAAAGAGCAGTGAAGCG
GATGATACTCAATATGTAAATCGAGACATGGAGTCCCAGGATTACAAGAAGGCTCCCAGATCAAAGAAATCCACCAGAGG
AATGAAAACCAAGGGCACAACGAAGAAAAACAGTAGCAATGAATGTGATAGATGTGGAGAGGAGTTTGAGTCGAGAACAA
AACTACACAAGCACTTGGCTGATAGTGGTCATGCGACAGTGAAATCCCGATGA